Recombinant Ailuropoda melanoleuca Metallophosphoesterase 1 (MPPE1)

Shipped with Ice Packs
In Stock

Description

General Information

Metallophosphoesterase 1 (MPPE1) is an enzyme involved in the transport of glycosylphosphatidylinositol (GPI)-anchor proteins from the endoplasmic reticulum to the Golgi apparatus and acts in lipid remodeling steps . MPPE1 is associated with a polymorphism linked to bipolar disorder . Studies show that MPPE1 is highly expressed in hepatocellular carcinoma (HCC) .

Gene Information

The human MPPE1 gene provides instructions for producing metallophosphoesterase 1 . It is located on chromosome 18 at position 11897016 .

Role in Hepatocellular Carcinoma (HCC)

MPPE1 has been identified as a potential therapeutic target for HCC, with mutation in the MPPE1 gene associated with tumor node metastasis (TNM) stage and Child–Pugh classification .

MPPE1 Expression

MPPE1 expression is significantly increased in HCC tumor samples compared to adjacent non-tumor tissues .

Impact of MPPE1 Down-regulation

Down-regulation of MPPE1 inhibits HCC cell proliferation and affects cell apoptosis . Transcriptional silencing of MPPE1 also inhibits tumor growth in vivo .

Association with Clinicopathological Features and Prognosis in HCC Patients

VariablesMPPE1 mutation Yes n (%)No n (%)P-value
Gender1.00
Male23 (95.8)91 (93.8)
Female1 (4.2)6 (6.2)
Age (yrs.)0.65
≤5012 (50.0)41 (42.3)
>5012 (50.0)56 (57.7)
Number of tumor nodules0.45
17 (29.2)41 (42.3)
2–312 (50.0)36 (37.1)
≥45 (20.8)20 (20.6)
Tumor size (cm)0.18
≤515 (62.5)83 (85.6)
>59 (37.5)14 (14.4)

HCC patients with the MPPE1 mutation showed a higher tumor recurrence rate than those without the MPPE1 mutation (P = .02) .

Single Nucleotide Polymorphisms (SNVs)

Genechr SNVA1F_AF_UA2OR (95% CI)P value
Recurrent HCC vs control
SPON1chr11_14284477A0.0440.023G1.89 (0.31–11.66)0.48
NOX5chr15_69325606C0.0440.023A1.94 (0.31–11.94)0.46
TP53chr17_7579801C0.410.55G0.55 (0.25–1.25)0.15
MPPE1chr18_11897016C0.180.035T5.93 (1.60–21.97)0.003
MYBPC2chr19_50967640A0.200.16G1.31 (0.57–3.02)0.52
Primary HCC vs control
SPON1chr11_14284477A0.0750.036G0.48 (0.067–3.49)0.46
NOX5chr15_69325606C0.0570.023A2.56 (9.5486–11.96)0.21
TP53chr17_7579801C0.450.55G0.68 (0.3–1.38)0.28
MPPE1chr18_11897016C0.0800.034T2.42 (0.68–8.66)0.16
MYBPC2chr19_50967640A0.150.16G0.92 (0.45–1.86)0.80

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPPE1; PGAP5; PANDA_019658; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Ailuropoda melanoleuca (Giant panda)
Target Names
MPPE1
Target Protein Sequence
MALIRLGFGRQHFCLLKRRSFLMLKLAALVFAVVLFCEFLIYYLVIFRCDWPEVKTPASD SGQKTLKAMFLADTHLLGEVRGHWLDKLRREWQMERAFQTALRLLQPEVVFILGDIFDEG KWSSSQAWADDVERFQKIFRHPRHVQLKVVAGNHDIGFHYQMNAYKIKRFEKVFSPERLF SWKGINFVMVNSVALEGDGCHICSEAEAELIEISRKLNCSRKQERRSGPCPDPQLLPASA PVLLQHFPLYRRSDANCSGEDAAPLEERGIPFKERYDVLSQEASQQLLWWLRPRLILSGH THSACEVLHGAEVPEISVPSFSWRNRNNPSFIMGSMTPTEYALAKCYLPYEDTVLATYCV AAGLLVVLILVHSELLPSPFLFGWNLLRKFKT
Uniprot No.

Target Background

Function

Metallophosphoesterase 1 (MPPE1) is essential for the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It plays a crucial role in GPI-anchor maturation through lipid remodeling. Specifically, MPPE1 removes an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI intermediate, a critical step enabling efficient transport of GPI-anchored proteins.

Database Links
Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is Metallophosphoesterase 1 and what is its biological function?

Metallophosphoesterase 1 (MPPE1), also known as Post-GPI attachment to proteins factor 5 (PGAP5), is an enzyme involved in the processing and maturation of glycosylphosphatidylinositol (GPI)-anchored proteins. In Ailuropoda melanoleuca (Giant panda), MPPE1 is identified with UniProt accession number D2I2M6 . The protein functions as a metallophosphoesterase with an EC classification of 3.1.-.- which indicates its enzymatic activity in hydrolyzing phosphoric monoesters .

Methodologically, researchers investigating MPPE1 function should employ:

  • Enzymatic assays with appropriate phosphorylated substrates

  • Cell-based trafficking studies of GPI-anchored proteins

  • Subcellular localization studies to confirm ER/Golgi distribution

  • Comparative analysis with MPPE1 from other species to identify conserved functions

What are the optimal storage and handling conditions for recombinant MPPE1?

For maintaining recombinant MPPE1 integrity and activity, the protein should be stored according to these specific parameters:

  • Storage buffer: Tris-based buffer containing 50% glycerol, specifically optimized for MPPE1 stability

  • Temperature conditions: Store at -20°C for regular use, or -20°C to -80°C for extended storage periods

  • Working conditions: Aliquots can be maintained at 4°C for up to one week

  • Stability precautions: Repeated freezing and thawing cycles should be strictly avoided

Research methodology should include stability validation through:

  • Activity assays before and after various storage conditions

  • SDS-PAGE analysis to confirm protein integrity

  • Creation of multiple small-volume aliquots to prevent repeated freeze-thaw cycles

  • Testing of various stabilizing additives if activity loss is observed

How should researchers design experiments to study MPPE1 function?

When designing experiments involving recombinant MPPE1, researchers should implement a systematic approach following these methodological principles:

  • Variable definition:

    • Independent variables: MPPE1 concentration, substrate types, cofactor presence

    • Dependent variables: Enzymatic activity, substrate conversion rates, kinetic parameters

    • Control variables: pH, temperature, buffer composition

  • Experimental controls:

    • Positive controls: Known phosphoesterase substrates with established kinetic parameters

    • Negative controls: Heat-inactivated MPPE1, buffer-only reactions

    • System-specific controls: Non-GPI anchor substrates to verify specificity

  • Experimental conditions:

    • Dose-response relationships: Activity across multiple MPPE1 concentrations

    • Time-course analysis: Reaction progress at defined time points

    • Metal dependency tests: Activity with various divalent cations and chelating agents

  • Statistical design:

    • Minimum of three biological replicates per condition

    • Technical triplicates within each biological replicate

    • Power analysis to determine appropriate sample sizes

What methods can be used to verify the enzymatic activity of recombinant MPPE1?

To assess and validate the enzymatic activity of recombinant MPPE1, researchers should employ multiple complementary approaches:

  • Phosphoesterase activity assays:

    • Colorimetric detection using p-nitrophenyl phosphate substrates

    • Malachite green assay for inorganic phosphate release quantification

    • Fluorogenic substrate assays for increased sensitivity

    • Mass spectrometry analysis of substrate conversion products

  • Kinetic characterization:

    • Determination of Km and Vmax values under varying conditions

    • Inhibition studies using metal chelators and phosphatase inhibitors

    • pH and temperature optimum profiling

    • Substrate specificity analysis across multiple potential substrates

  • Verification protocol:

    • Initial activity screening at multiple enzyme concentrations

    • Establishment of linear range for reaction conditions

    • Confirmation of metal ion dependency (likely zinc or manganese)

    • Comparison with commercially available phosphoesterases as standards

How is MPPE1 implicated in hepatocellular carcinoma research?

MPPE1 has emerged as a potential candidate gene in hepatocellular carcinoma (HCC), with significant research implications:

  • Genetic association evidence:

    • MPPE1 mutation at chromosome position 18_11897016 (C allele) shows significant association with recurrent HCC (Odds Ratio = 5.93, 95% CI: 1.60–21.97, p=0.003)

    • The allele frequency of this mutation is substantially higher in recurrent HCC cases (0.18) compared to controls (0.035)

    • The association appears stronger in recurrent HCC than primary HCC (OR=2.42, p=0.16 in primary HCC)

  • Expression analysis findings:

    • Analysis of publicly available data from GEO and TCGA databases demonstrates significantly increased MPPE1 expression levels in HCC tumors

  • Research methodology implications:

    • Case-control studies should stratify by primary versus recurrent HCC status

    • Genotyping of the chr18_11897016 locus should be prioritized

    • Functional studies should evaluate the impact of this specific mutation on enzymatic activity

Genechr SNVA1F_AF_UA2OR (95% CI)P value
MPPE1chr18_11897016C0.180.035T5.93 (1.60–21.97)0.003

Table 1: Statistical analysis of MPPE1 mutation in recurrent HCC versus control subjects

What techniques are recommended for studying MPPE1 mutations and their functional implications?

To comprehensively investigate MPPE1 mutations identified in disease contexts, researchers should implement:

  • Genetic characterization methods:

    • Next-generation sequencing to identify additional mutations in the MPPE1 gene

    • Digital droplet PCR for precise quantification of mutation frequency

    • Sanger sequencing validation of key variants

    • Linkage disequilibrium analysis with nearby genetic markers

  • Functional genomics approaches:

    • CRISPR/Cas9 genome editing to introduce the chr18_11897016 C>T mutation in cell models

    • Site-directed mutagenesis of recombinant MPPE1 to create protein variants

    • Stable cell lines expressing wild-type versus mutant MPPE1

    • Transcriptome analysis following MPPE1 modulation

  • Biochemical characterization:

    • Enzymatic activity comparison between wild-type and mutant proteins

    • Structural analysis using X-ray crystallography or cryo-EM

    • Thermal stability assessment using differential scanning fluorimetry

    • Protein-protein interaction studies using co-immunoprecipitation

  • Cellular phenotype analysis:

    • Cell proliferation, migration, and invasion assays

    • Analysis of GPI-anchored protein trafficking

    • Subcellular localization studies of mutant versus wild-type MPPE1

    • Xenograft models with cells expressing MPPE1 variants

How should researchers analyze genetic data related to MPPE1 mutations?

For robust analysis of MPPE1 genetic data, researchers should implement these methodological approaches:

  • Association analysis framework:

    • Case-control comparisons with appropriate matching of demographic factors

    • Calculation of odds ratios with 95% confidence intervals

    • Application of Chi-square or Fisher's exact tests for significance

    • Adjustment for multiple testing when analyzing multiple variants

  • Genetic model testing:

    • Additive model analysis as demonstrated in the HCC study

    • Investigation of dominant and recessive inheritance models

    • Haplotype analysis when multiple variants are present

    • Assessment of gene-environment interactions

  • Variant interpretation pipeline:

    • In silico prediction of mutation effects using SIFT, PolyPhen, or PROVEAN

    • Conservation analysis across species using multiple sequence alignment

    • Structural mapping of mutations to functional domains

    • Integration with public databases (gnomAD, ClinVar) for population frequencies

  • Data visualization approaches:

    • Manhattan plots for genome-wide studies

    • Forest plots for meta-analysis of multiple studies

    • Protein diagrams showing mutation locations relative to domains

    • Comparative tables showing association statistics across different cohorts

How can researchers resolve contradictory findings about MPPE1 function?

When encountering contradictory results regarding MPPE1 function, researchers should employ these methodological strategies:

  • Systematic investigation of context-dependency:

    • Cell type-specific effects: Test multiple relevant cell lines

    • Species differences: Compare MPPE1 from human, panda, and other mammals

    • Environmental factors: Vary experimental conditions systematically

    • Genetic background: Consider the impact of different genetic contexts

  • Technical reconciliation approaches:

    • Standardization of protein production and purification methods

    • Harmonization of activity assay conditions across laboratories

    • Round-robin testing between research groups

    • Development of reference standards and controls

  • Integration of multiple lines of evidence:

    • Correlation of in vitro enzymatic data with cellular phenotypes

    • Cross-validation between recombinant protein studies and cell-based approaches

    • Combination of structural, biochemical, and genetic evidence

    • Meta-analysis of published studies with attention to methodological differences

  • Resolution of HCC-specific contradictions:

    • The observed difference between primary HCC (OR=2.42, p=0.16) and recurrent HCC (OR=5.93, p=0.003) associations suggests MPPE1 may have context-specific roles

    • Analysis of tumor evolution from primary to recurrent disease

    • Stratification by clinical variables such as number of tumor nodules and tumor size

    • Investigation of treatment-related effects on MPPE1 expression or mutation status

What are the critical quality control measures for recombinant MPPE1 production?

To ensure reproducible results with recombinant MPPE1, researchers should implement these quality control procedures:

  • Protein integrity verification:

    • SDS-PAGE with Coomassie staining to confirm expected molecular weight (~43 kDa)

    • Western blot using anti-MPPE1 or anti-tag antibodies

    • Mass spectrometry verification of full-length protein

    • N-terminal sequencing to confirm proper processing

  • Purity assessment:

    • Densitometric analysis of SDS-PAGE bands (target >95% purity)

    • Size-exclusion chromatography to detect aggregates

    • Endotoxin testing for proteins produced in bacterial systems

    • Host cell protein quantification using ELISA

  • Functional validation:

    • Batch-to-batch enzymatic activity comparison

    • Thermal stability verification

    • Specific activity calculation (activity units per mg protein)

    • Long-term stability testing under recommended storage conditions

  • Structural characterization:

    • Circular dichroism to verify secondary structure content

    • Dynamic light scattering for monodispersity assessment

    • Limited proteolysis to confirm proper folding

    • Analytical ultracentrifugation for oligomeric state determination

How can researchers develop assays to study MPPE1 interaction with GPI-anchored proteins?

To investigate MPPE1's role in GPI-anchor processing, researchers should develop specialized assays:

  • Cell-free GPI processing assays:

    • Preparation of radiolabeled or fluorescently-labeled GPI precursors

    • In vitro reaction system with purified MPPE1 and GPI substrates

    • Thin-layer chromatography or HPLC analysis of reaction products

    • Mass spectrometry characterization of GPI anchor modifications

  • Cellular GPI-anchored protein trafficking:

    • Expression of fluorescently-tagged GPI-anchored reporter proteins

    • Live-cell imaging to track trafficking in the presence/absence of MPPE1

    • Surface biotinylation assays to quantify plasma membrane delivery

    • Flow cytometry for quantitative assessment of surface expression

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of MPPE1 with GPI biosynthesis machinery

    • Proximity labeling approaches (BioID, APEX) to identify interaction partners

    • FRET or BRET assays for direct interaction assessment

    • Yeast two-hybrid screening for novel interactors

  • Structural docking approaches:

    • In silico modeling of MPPE1-substrate interactions

    • Mutational analysis of predicted binding sites

    • Cross-linking mass spectrometry to map interaction interfaces

    • Surface plasmon resonance for binding kinetics determination

What are the implications of MPPE1 research for understanding evolutionary conservation of GPI-anchor processing?

The availability of recombinant Ailuropoda melanoleuca MPPE1 provides unique opportunities for evolutionary studies:

  • Comparative enzymology approaches:

    • Side-by-side activity assays of MPPE1 from panda, human, and other species

    • Substrate specificity profiles across evolutionary diverse MPPE1 orthologs

    • Kinetic parameter comparison to identify conserved catalytic properties

    • Structural comparison of active sites and substrate binding pockets

  • Sequence-function relationship analysis:

    • Multiple sequence alignment of MPPE1 across mammals, vertebrates, and eukaryotes

    • Identification of absolutely conserved residues versus species-specific variations

    • Correlation of sequence conservation with enzymatic properties

    • Ancestral sequence reconstruction and resurrection

  • GPI-anchor processing pathway evolution:

    • Comparative genomics of the entire GPI biosynthesis and processing machinery

    • Co-evolution analysis of MPPE1 with other pathway components

    • Investigation of species-specific adaptations in GPI processing

    • Correlation with species-specific GPI-anchored proteome differences

  • Experimental design considerations:

    • Use of equivalent substrates for cross-species comparisons

    • Standardized reaction conditions adjusted for physiological differences

    • Expression in identical systems to minimize production-related variables

    • Statistical approaches for multi-species data integration

How might MPPE1 serve as a potential therapeutic target in hepatocellular carcinoma?

Based on the identified association between MPPE1 mutations and HCC , several therapeutic development approaches should be considered:

  • Target validation strategies:

    • Gene knockdown studies in HCC cell lines and xenograft models

    • CRISPR/Cas9 correction of MPPE1 mutations in patient-derived cells

    • Analysis of synthetic lethality with other HCC-related pathways

    • Correlation of MPPE1 expression/mutation with patient outcomes

  • Small molecule development pipeline:

    • High-throughput screening for MPPE1 inhibitors

    • Structure-based drug design targeting the metallophosphoesterase active site

    • Fragment-based screening approaches

    • Repurposing of existing phosphatase inhibitors

  • Biomarker development:

    • MPPE1 mutation testing as a recurrence risk predictor

    • Development of immunohistochemistry protocols for MPPE1 detection

    • Correlation of MPPE1 expression with response to existing therapies

    • Liquid biopsy approaches for detecting MPPE1 mutations

  • Therapeutic hypothesis testing:

    • Investigation of whether MPPE1 inhibition affects specific GPI-anchored proteins relevant to HCC

    • Assessment of combination approaches with existing HCC treatments

    • Evaluation of potential synthetic lethality with other genetic alterations common in HCC

    • Exploration of selective delivery systems to target MPPE1 inhibitors to HCC cells

What are the current technical limitations in MPPE1 research and how can they be addressed?

Researchers face several methodological challenges when studying MPPE1:

  • Enzymatic activity measurement:

    • Challenge: Lack of standardized, specific substrates for MPPE1

    • Solution: Development of fluorogenic substrates that mimic natural GPI intermediates

    • Challenge: Low throughput of existing assays

    • Solution: Adaptation to microplate format with automated readouts

  • Structural characterization:

    • Challenge: Difficulty obtaining crystal structures of membrane-associated proteins

    • Solution: Expression of soluble catalytic domains or use of cryo-EM

    • Challenge: Modeling post-translational modifications

    • Solution: Expression in eukaryotic systems that maintain physiological modifications

  • Disease-relevant mutations:

    • Challenge: Unknown functional impact of the chr18_11897016 C>T mutation

    • Solution: Creation of isogenic cell lines differing only in this mutation

    • Challenge: Potential tissue-specific effects

    • Solution: Use of relevant primary cells or organoids rather than established cell lines

  • Translational relevance:

    • Challenge: Connecting biochemical findings to disease mechanisms

    • Solution: Integration of patient data with experimental results

    • Challenge: Species differences between panda and human MPPE1

    • Solution: Parallel studies with both orthologs to identify conserved mechanisms

How can researchers integrate computational and experimental approaches in MPPE1 studies?

A comprehensive understanding of MPPE1 requires integration of computational and wet-lab methodologies:

  • Structure-function prediction:

    • Computational: Homology modeling and molecular dynamics simulations

    • Experimental validation: Site-directed mutagenesis of predicted functional residues

    • Integration: Refinement of computational models based on experimental results

    • Application: Prediction of mutation effects on protein stability and function

  • Pathway analysis:

    • Computational: Network analysis of MPPE1-associated pathways

    • Experimental validation: Targeted proteomics of predicted interaction partners

    • Integration: Systems biology models incorporating quantitative data

    • Application: Identification of potential synthetic lethal interactions

  • Evolutionary analysis:

    • Computational: Phylogenetic analysis and ancestral state reconstruction

    • Experimental validation: Functional testing of MPPE1 from multiple species

    • Integration: Correlation of sequence conservation with functional conservation

    • Application: Identification of species-specific therapeutic targeting opportunities

  • Clinical data integration:

    • Computational: Mining of -omics databases for MPPE1 associations

    • Experimental validation: Testing of computational predictions in patient samples

    • Integration: Machine learning approaches combining multiple data types

    • Application: Development of predictive models for patient stratification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.