Recombinant Ailuropoda melanoleuca ORM1-like protein 3 (ORMDL3)

What is Ailuropoda melanoleuca ORMDL3 and how does it compare to human ORMDL3?

ORMDL3 (ORM1-like protein 3) from Ailuropoda melanoleuca (Giant panda) is a transmembrane protein that belongs to the evolutionarily conserved ORMDL gene family. The recombinant form is available for research purposes and consists of 153 amino acids . The protein sequence (MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNTGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY) reveals structural elements consistent with its role as a transmembrane protein . Human ORMDL3 has been extensively studied as an asthma candidate gene, with genome-wide association studies identifying single nucleotide polymorphisms (SNPs) in the region including ORMDL3 on chromosome 17q21 related to childhood asthma risk .

What are the known cellular localizations and tissue expression patterns of ORMDL3?

ORMDL3 encodes transmembrane proteins located at the endoplasmic reticulum (ER) membrane . The protein is ubiquitously expressed in human tissues, suggesting it serves fundamental cellular functions across different cell types . In humans, the most dramatic changes in ORMDL3 expression were noted in immune cells, particularly in CD4+ T lymphocytes from patients harboring the 17q12-21 risk SNPs, which showed a 3-fold increase in ORMDL3 mRNA . This preferential expression pattern highlights the potential significance of ORMDL3 in immune cell function and inflammatory responses.

What storage and handling protocols are recommended for recombinant ORMDL3 proteins?

For optimal stability and activity, recombinant Ailuropoda melanoleuca ORMDL3 should be stored in a Tris-based buffer with 50% glycerol . The protein should be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended . Repeated freezing and thawing should be avoided to maintain protein integrity. For short-term use, working aliquots can be stored at 4°C for up to one week . These storage conditions help preserve the native conformation and biological activity of the recombinant protein for experimental applications.

How is ORMDL3 linked to asthma pathogenesis?

Genome-wide association studies have identified ORMDL3 as a significant asthma candidate gene . Multiple SNPs on chromosome 17q21 have been statistically significantly associated with childhood asthma in various populations . A meta-analysis of five published studies on rs7216389 in nine populations gave an odds ratio for asthma of 1.44 (95% CI, 1.35-1.54, P < 0.00001), confirming the association between ORMDL3 polymorphisms and asthma risk .
The mechanistic link between ORMDL3 and asthma involves several pathways. Global Ormdl3 overexpression in mouse models led to increased pathology and airway hyper-reactivity at baseline and in ovalbumin-induced asthma models . Enhanced ORMDL3 expression in T cells was shown to have functional consequences, including reduced expression of interleukin-2 (IL-2), suggesting a direct intrinsic role for increased ORMDL3 expression in T cells driving heightened asthma pathophysiology .

What is the relationship between ORMDL3 and sphingolipid regulation in disease models?

ORMDL3 plays a crucial role in sphingolipid regulation, which may contribute to its effects on asthma pathogenesis and other inflammatory conditions. Altered sphingolipid metabolism affects T cell function, potentially linking ORMDL3 to immune dysregulation in asthma . The connection between sphingolipid regulation and T cell function represents a mechanistic pathway by which ORMDL3 variants might predispose to asthma and other inflammatory diseases .
Research suggests that ORMDL3-mediated alterations in sphingolipid metabolism may impact various cellular processes, including endoplasmic reticulum stress responses and inflammatory signaling pathways, which are implicated in asthma pathogenesis .

Beyond asthma, what other inflammatory conditions have been linked to ORMDL3 expression?

Multiple studies have directly linked ORMDL3 overexpression with other human inflammatory disorders beyond asthma. Large genome-wide association studies have identified significant associations between ORMDL3 expression and inflammatory bowel diseases (IBD), including Crohn's disease and ulcerative colitis . ORMDL3 is also implicated as a causal gene in rheumatoid arthritis, an autoimmune disorder characterized by chronic inflammation of the joints .
Interestingly, contrasting findings exist for type 1 diabetes, where children with the condition had significantly lower ORMDL3 expression in peripheral blood leukocytes compared to healthy children . ORMDL3 was implicated in promoting islet beta cell proliferation by activating transcription of ATF6, a major unfolded protein response (UPR) protein . These diverse associations highlight the complex role of ORMDL3 in inflammatory and autoimmune conditions.

What are the optimal experimental conditions for studying ORMDL3 function in vitro?

When designing in vitro experiments to study ORMDL3 function, researchers should consider several methodological factors:

• Cell line selection: Since ORMDL3 exhibits differential expression across cell types, with particularly high expression in immune cells such as CD4+ T lymphocytes, choosing appropriate cell lines or primary cells is crucial . For immunological studies, T cell lines or primary T cells isolated from peripheral blood may be optimal.

• Expression systems: For recombinant protein studies, the expression system should be selected based on the experimental goals. The recombinant Ailuropoda melanoleuca ORMDL3 is available as a full-length protein (amino acids 1-153), which can be used for various in vitro applications .

• Functional assays: Given ORMDL3's role in sphingolipid regulation and ER stress responses, assays measuring these pathways (such as sphingolipid metabolite quantification, ER stress marker expression, or UPR activation) would be appropriate for functional studies .

• Controls: Appropriate controls should include cells with normal ORMDL3 expression levels for comparison with overexpression or knockdown conditions to accurately assess functional effects.

What genotyping strategies are most effective for ORMDL3-related polymorphisms in clinical studies?

For clinical studies investigating ORMDL3-related polymorphisms, the following genotyping strategies have proven effective:

• SNP selection: Focus on well-validated SNPs with established associations with asthma and ORMDL3 expression, such as rs4378650 in ORMDL3 and rs7216389 in the adjacent GSDML gene, which have shown significant associations with childhood asthma in multiple populations .

• Genotyping methods: TaqMan SNP Genotyping Assay has been successfully used for genotyping ORMDL3-related polymorphisms . This method involves PCR amplification using the 5′ exonuclease assay followed by fluorescence detection using sequence detection systems .

• Quality control: Implement rigorous quality control measures, including the use of known genotype controls and blind replicate samples to ensure accurate genotyping . A minimum plate assay efficiency of 99% should be targeted .

• Non-parentage verification: In family-based studies, verify biological relationships using short-tandem repeats analyzed with appropriate software (e.g., PEDCHECK) to ensure accurate genetic analysis .

How can researchers effectively measure ORMDL3 expression levels in different cell populations?

To accurately measure ORMDL3 expression levels across different cell populations, researchers should consider these methodological approaches:

• RNA-based methods: Quantitative RT-PCR can be used to measure ORMDL3 mRNA expression levels with high sensitivity. This technique was employed in studies showing a 3-fold increase in ORMDL3 mRNA in CD4+ T lymphocytes from patients with 17q12-21 risk SNPs .

• Protein detection: Western blotting or immunofluorescence using specific antibodies against ORMDL3 can visualize and quantify protein expression in different cell types.

• Cell isolation techniques: For studying expression in specific immune cell subsets, fluorescence-activated cell sorting (FACS) or magnetic-activated cell sorting (MACS) can isolate pure populations before expression analysis.

• Single-cell approaches: For heterogeneous samples, single-cell RNA sequencing can provide detailed information about ORMDL3 expression in individual cells across different populations.

• Control for genetic background: When comparing expression levels, controlling for ORMDL3-related genetic variants is essential, as these can significantly influence expression levels .

How can transgenic models be utilized to study ORMDL3 function in vivo?

Transgenic models have provided valuable insights into ORMDL3 function in vivo, particularly in the context of asthma research:

• Global overexpression models: Transgenic mice with global Ormdl3 overexpression have shown increased pathology and airway hyper-reactivity at baseline and in ovalbumin-induced asthma models . These models help elucidate how increased ORMDL3 expression contributes to asthma pathogenesis.

• Tissue-specific expression: Models with tissue-specific ORMDL3 overexpression can distinguish the relative contributions of ORMDL3 in different cell types. For example, studies have investigated effects in both immune cells (T cells) and non-immune cells (airway smooth muscle, bronchial epithelial cells) to determine which cellular compartments mediate ORMDL3's effects on asthma pathophysiology .

• Response to allergen challenge: Challenging transgenic ORMDL3-overexpressing mice with allergens has revealed increased Th2 responses and airway hyperresponsiveness, mimicking aspects of human asthma . This approach helps establish causality between ORMDL3 expression and asthma-like phenotypes.

• Therapeutic testing platforms: Transgenic models can be used to test potential therapeutics targeting ORMDL3 or its downstream pathways. New treatments to reduce ORMDL3 expression in the lungs have yielded promising results in ameliorating airway inflammation in mice .

What are the current technical challenges in studying ORMDL3 protein interactions and how can they be addressed?

Studying ORMDL3 protein interactions presents several technical challenges that researchers should consider:

• Membrane protein nature: As a transmembrane protein localized to the ER membrane , ORMDL3 poses challenges for structural studies and interaction analyses. Approaches such as detergent-based solubilization or membrane-mimetic systems may be necessary for in vitro studies.

• Interaction identification: Techniques such as co-immunoprecipitation followed by mass spectrometry, proximity labeling approaches (BioID, APEX), or yeast two-hybrid systems adapted for membrane proteins can help identify ORMDL3 interaction partners.

• Functional validation: After identifying potential interactions, functional validation through targeted mutagenesis of interaction domains, competitive inhibition, or selective knockdown of interaction partners is essential to confirm biological relevance.

• Cellular context: Given ORMDL3's differential effects across cell types, studying interactions in relevant cellular contexts (e.g., T cells for immune-related functions, airway cells for asthma-related effects) will provide the most physiologically meaningful results.

• Integration with omics data: Integrating interaction data with transcriptomics, proteomics, or metabolomics datasets can help place ORMDL3 interactions within broader cellular networks and pathways.

How do ORMDL3 polymorphisms affect endoplasmic reticulum stress and the unfolded protein response?

ORMDL3 polymorphisms associated with asthma and other inflammatory conditions appear to influence endoplasmic reticulum (ER) stress and the unfolded protein response (UPR):

• ER stress induction: ORMDL3 overexpression has been linked to chronic ER stress in various tissues, including gut epithelium in inflammatory bowel disease and synovial tissues in rheumatoid arthritis . This suggests polymorphisms increasing ORMDL3 expression may promote ER stress conditions.

• UPR activation: ORMDL3 has been implicated in promoting islet beta cell proliferation by activating transcription of ATF6, a major UPR protein . The UPR triggers cleavage of membrane ATF6, releasing its cytoplasmic domain for nuclear translocation and transactivation of chaperone genes that help resolve ER stress .

• Inflammatory signaling: ORMDL3-mediated ER stress and UPR activation may exacerbate proinflammatory cytokine production and tissue inflammation associated with autoimmune disorders . This represents a plausible mechanism connecting changes in ORMDL3 expression to inflammation in conditions like asthma, IBD, and rheumatoid arthritis.

• Therapeutic implications: Understanding these pathways provides potential therapeutic targets. Interventions aimed at reducing ORMDL3 expression or mitigating its effects on ER stress have shown promise in ameliorating airway inflammation in mouse models .

What are the current gaps in understanding species-specific differences in ORMDL3 function?

Despite advances in ORMDL3 research, several gaps remain in understanding species-specific differences:

• Evolutionary conservation: While ORMDL genes are evolutionarily conserved , detailed comparative analyses of ORMDL3 function across species, including Ailuropoda melanoleuca (Giant panda), humans, and other mammals, are lacking. Further research is needed to determine whether findings from one species can be reliably extrapolated to others.

• Structural comparisons: Detailed structural analyses comparing ORMDL3 proteins from different species could reveal conserved functional domains and species-specific adaptations. The available sequence for Ailuropoda melanoleuca ORMDL3 provides a starting point for such comparisons.

• Functional equivalence: Studies testing the functional equivalence of ORMDL3 from different species in cellular models would help determine whether species-specific variants can complement each other's functions or exhibit unique properties.

• Regulatory differences: The regulation of ORMDL3 expression may vary between species, potentially leading to differences in tissue distribution or response to environmental triggers. Comparative genomics approaches could identify conserved and divergent regulatory elements.

How might targeting ORMDL3 lead to novel therapeutic approaches for inflammatory diseases?

The emerging understanding of ORMDL3's role in inflammatory diseases suggests several potential therapeutic strategies:

• Direct ORMDL3 inhibition: Developing compounds that specifically inhibit ORMDL3 function or expression could provide targeted therapy for asthma and other inflammatory conditions. Studies in mice have shown that reducing ORMDL3 expression in the lungs ameliorates airway inflammation .

• Targeting downstream pathways: Rather than targeting ORMDL3 directly, interventions aimed at modulating its downstream effects—such as sphingolipid metabolism, ER stress, or specific inflammatory pathways—may prove effective while potentially reducing off-target effects.

• Cell-specific approaches: Given ORMDL3's differential expression and functions across cell types, developing cell-targeted approaches (e.g., targeting T cells for asthma or joint tissues for rheumatoid arthritis) could enhance therapeutic specificity.

• Genetic stratification: ORMDL3-related genetic variants could be used for patient stratification in clinical trials, identifying individuals most likely to benefit from specific interventions targeting this pathway.

• Combination therapies: Combining ORMDL3-targeted approaches with existing treatments for inflammatory diseases might enhance efficacy through synergistic effects on different aspects of disease pathophysiology.

What methodological advances are needed to better understand the complex role of ORMDL3 in cellular homeostasis?

Advancing our understanding of ORMDL3's complex role in cellular homeostasis will require several methodological innovations:

• Improved temporal and spatial resolution: Developing tools for real-time monitoring of ORMDL3 activity and localization within living cells would provide insights into its dynamic roles in cellular processes.

• Systems biology approaches: Integrating multiple omics datasets (transcriptomics, proteomics, metabolomics, especially focusing on sphingolipids) in ORMDL3-manipulated systems could reveal the broader cellular networks influenced by this protein.

• Advanced in vivo imaging: Methods for non-invasive tracking of ORMDL3 expression and activity in animal models would help connect cellular findings to tissue and organism-level phenotypes.

• Single-cell multiomics: Applying single-cell approaches that simultaneously measure gene expression, protein levels, and metabolite profiles would help untangle cell-type-specific effects of ORMDL3 in heterogeneous tissues.

• Computational modeling: Developing computational models of ORMDL3-influenced pathways could help predict system-level responses to perturbations and guide experimental design for complex interactions.

• Precision genetic tools: Advanced genome editing techniques allowing precise manipulation of ORMDL3 expression, splicing, or specific functional domains would enable more sophisticated functional studies than current overexpression or knockout approaches.