Recombinant Ailuropoda melanoleuca Probable polyprenol reductase (SRD5A3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene name: SRD5A3 (Steroid 5 Alpha-Reductase 3)
Alternative names: Polyprenol reductase, 3-oxo-5-alpha-steroid 4-dehydrogenase 3 .

Key Functional Domains:

Domain/RegionFunction
1-318 residuesFull-length catalytic domain for polyprenol reduction .
NADP-binding siteCritical for redox activity during dolichol biosynthesis .

Protein Sequence (Partial):

MAPWAAAQLWALNPLRALWLTLAAAFLLTLLLQLVPPGLLPGCALFQDLIRYGKTKREGQSRPAVCRVFDVPKRYFSHFYIISALWNGFLLWHLTQSVFLGVPFPNWLHGLLRILGASQFQGGELALSAFLVLVFLWLHSLRRLFECFYVSVFSNTVIHIVQYCFGLVYYVLTGLTVLSQVPMDGRNAYVIGKNLLMQARWFHILGmLMFIWSSVHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYISMAVTFGFHNLTWWLVVTYVFFSQALSAFLSHKFYK SKFVSYPKHRKAFLPFLF .

Physicochemical Properties:

  • Host systems: Expressed in E. coli, yeast, baculovirus, or mammalian cells .

  • Purity: ≥85% as verified by SDS-PAGE .

  • Storage: Stable at -20°C or -80°C in Tris-based buffer with 50% glycerol .

Comparison of Recombinant SRD5A3 Variants:

SpeciesHost SystemPurityApplications
Ailuropoda melanoleucaCell-free expression or E. coli/yeast≥85%ELISA, functional studies
Danio rerio (zebrafish)E. coli/yeast≥85%Comparative enzymology
Mus musculus (mouse)Mammalian cells≥85%Disease modeling

Key Challenges:

  • Low solubility in non-optimized buffers .

  • Sensitivity to repeated freeze-thaw cycles .

Functional Studies

  • Glycosylation assays: Used to study dolichol phosphate synthesis in congenital disorders of glycosylation (CDG) .

  • Enzyme kinetics: Measures NADP-dependent reductase activity .

Diagnostic Tools

  • ELISA kits: Commercial assays (e.g., CSB-CF022655AYX) utilize this recombinant protein to quantify SRD5A3 levels in clinical samples .

Therapeutic Development

  • Target for CDG therapies: Mutations in SRD5A3 cause SRD5A3-CDG, characterized by neurological and ocular defects .

Critical Research Findings

  1. Conserved function: The giant panda SRD5A3 ortholog rescues glycosylation defects in yeast (dfg10Δ mutants), confirming evolutionary conservation .

  2. Pathogenic relevance: Truncating mutations (e.g., p.Trp19Ter) impair dolichol synthesis, leading to hypoglycosylation of rhodopsin and retinal dystrophy .

  3. Structural insights: The enzyme’s transmembrane domains anchor it to the endoplasmic reticulum, facilitating polyprenol access .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
SRD5A3; PANDA_008038; Polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; Steroid 5-alpha-reductase 3; S5AR 3; SR type 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Ailuropoda melanoleuca (Giant panda)
Target Names
SRD5A3
Target Protein Sequence
MAPWAAAQLWALNPLRALWLTLAAAFLLTLLLQLVPPGLLPGCALFQDLIRYGKTKREGQ SRPAVCRVFDVPKRYFSHFYIISALWNGFLLWHLTQSVFLGVPFPNWLHGLLRILGASQF QGGELALSAFLVLVFLWLHSLRRLFECFYVSVFSNTVIHIVQYCFGLVYYVLTGLTVLSQ VPMDGRNAYVIGKNLLMQARWFHILGMLMFIWSSVHQYKCHVILGNLRKNKAGVVIHCNH RIPFGDWFEYVSSPNYLAELMIYISMAVTFGFHNLTWWLVVTYVFFSQALSAFLSHKFYK SKFVSYPKHRKAFLPFLF
Uniprot No.

Target Background

Function
This protein plays a crucial role in the initial stages of protein N-linked glycosylation. It is essential for the conversion of polyprenol to dolichol, which are necessary for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used in N-glycosylation. It functions as a NADP-dependent polyprenol reductase, catalyzing the reduction of the alpha-isoprene unit of polyprenols to dolichols. Additionally, this protein exhibits the ability to convert testosterone (T) to 5-alpha-dihydrotestosterone (DHT).
Database Links
Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SRD5A3 and what is its primary biological function?

The enzyme belongs to the steroid 5-alpha-reductase family, with EC classification 1.3.1.- (probable polyprenol reductase) and 1.3.99.5 (3-oxo-5-alpha-steroid 4-dehydrogenase) . This protein plays a crucial role in glycosylation pathways, with mutations in the gene causing SRD5A3-CDG, a congenital disorder of glycosylation characterized by ophthalmological abnormalities and variable neurological symptoms .

How does SRD5A3 contribute to the dolichol biosynthesis pathway?

  • The cis-prenyl transferase complex adds 10-18 isoprene units from isopentenyl diphosphate (IPP) to farnesyl diphosphate (FPP), resulting in polyprenol .

  • Rather than directly converting polyprenol to dolichol, the pathway involves a three-step detour:

    • First step: DHRSX enzyme catalyzes an initial reaction

    • Second step: SRD5A3 catalyzes the intermediate conversion

    • Third step: DHRSX completes the pathway to form dolichol

This revised understanding explains why both DHRSX and SRD5A3 deficiencies result in glycosylation disorders, as both enzymes are required for proper dolichol synthesis .

What are the clinical implications of SRD5A3 deficiency?

SRD5A3 deficiency leads to SRD5A3-CDG, an autosomal recessive congenital disorder of glycosylation. Key clinical manifestations include:

Clinical FeaturePrevalenceDetails
Ophthalmological abnormalities≥90%Retinitis pigmentosa/retinal dystrophy, optic nerve hypoplasia, nystagmus, early onset visual impairment
Intellectual disabilityVariableRanges from mild to severe, with intra-familial variability
Cerebellar abnormalitiesCommonAtaxia (45% in studied cohort), cerebellar atrophy or vermis malformations
Neurological symptomsVariableHypotonia, intellectual disability, autism spectrum disorder in severe cases
Psychological features~60% in femalesAnxiety or mood alterations, particularly in females with visual impairment

SRD5A3-CDG is an ultrarare CDG subtype, reported in approximately 38 patients globally . The severity of presentation varies, potentially due to residual enzyme activity in some patients or alternative biosynthetic pathways for dolichol synthesis .

What experimental approaches are most effective for characterizing recombinant SRD5A3 activity?

Effective experimental characterization of recombinant SRD5A3 activity requires multiple complementary approaches:

  • Enzyme activity assays:

    • In vitro assays measuring the conversion of intermediates in the revised dolichol pathway, not just direct polyprenol-to-dolichol conversion

    • Coupling assays with both SRD5A3 and DHRSX to assess the complete pathway

    • Utilizing LC-MS to detect and quantify pathway intermediates and products

  • Structural and binding studies:

    • Molecular modeling of cofactor binding (NAD+ or NADP+) using tools like "AlphaFill"

    • Site-directed mutagenesis of key residues (e.g., Val181) predicted to interact with the cofactor

    • Analysis of the hydrophobic channel that may facilitate substrate access

  • Cell-based functional assays:

    • CRISPR/Cas9 knockout of SRD5A3 in cell lines followed by metabolic profiling

    • Glycoprotein analysis (e.g., LAMP2 mobility shifts) to detect N-glycosylation defects

    • Complementation studies with wild-type vs. mutant SRD5A3

When expressing recombinant SRD5A3, consider using detergent solubilization and purification methods appropriate for membrane-associated enzymes, and ensure proper folding through activity validation assays.

How does SRD5A3 expression correlate with disease states in current research?

Recent studies have identified significant correlations between SRD5A3 expression and specific disease states:

What are the relationships between SRD5A3 mutations and pathophysiology of SRD5A3-CDG?

The pathophysiological mechanisms linking SRD5A3 mutations to clinical features involve multiple glycosylation pathways:

  • Retinal pathology mechanisms:

    • Hypo-glycosylation of rhodopsin (which has two N-glycosylation sites) may affect its normal incorporation and function in rod photoreceptor outer segments

    • Defective rhodopsin glycosylation can lead to impaired phototransduction, vision loss, and retinal dystrophy

    • Supporting evidence comes from DHDDS-CDG studies, where suppression of DHDDS expression in zebrafish leads to loss of photoreceptor outer segments and visual function

  • Cerebellar abnormalities:

    • Mouse models with cerebellum-specific knockout of SRD5A3 show motor coordination defects and abnormal granule cell development

    • Proteomic studies confirm SRD5A3 loss affects highly glycosylated proteins

    • Impaired IgSF-CAM–mediated neurite growth and axon guidance in the cerebellum contributes to cerebellar signs and symptoms

    • Highly glycosylated IgSF-CAM members play critical roles in both the central nervous system and developing eye, potentially explaining both cerebellar and ocular manifestations

  • Neuronal migration defects:

    • SRD5A3-CDG may affect O-mannosylation, which could contribute to neuronal migration defects such as frontal microgyria

    • This connects to the mechanisms seen in O-glycosylation defects like dystroglycanopathies

How can researchers effectively design experiments to investigate the revised dolichol synthesis pathway?

Based on recent findings challenging the traditional role of SRD5A3, researchers should consider the following experimental design strategies:

  • Metabolomic profiling approaches:

    • Utilize LC-MS to simultaneously detect polyprenol, dolichol, and intermediate metabolites

    • Compare metabolite profiles in wild-type, SRD5A3-knockout, and DHRSX-knockout cell lines

    • Consider stable isotope labeling to track the flow of metabolites through the pathway

  • Enzyme cooperation studies:

    • Design reconstitution experiments with purified DHRSX and SRD5A3

    • Assess enzymatic activity with various substrate combinations to define the precise reactions catalyzed by each enzyme

    • Investigate potential complex formation between the enzymes

  • Structure-function analyses:

    • Create point mutations in the predicted NAD(P)+ binding site and substrate channel

    • Focus on conserved residues like Val181, which is predicted to interact with the cofactor

    • Correlate structural changes with enzymatic activity and cellular phenotypes

  • Therapeutic screening approaches:

    • Develop high-throughput assays to identify compounds that might bypass or compensate for defects in either enzyme

    • Consider alternative pathway activation, as suggested by observations of mevalonate pathway upregulation in some SRD5A3 mutants

    • Test candidate compounds in patient-derived cell lines to assess rescue of glycosylation defects

What are the optimal expression systems for recombinant Ailuropoda melanoleuca SRD5A3?

When expressing recombinant Ailuropoda melanoleuca SRD5A3, researchers should consider:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO) offer proper post-translational modifications and membrane insertion

    • Insect cell systems (Sf9, Hi5) can provide higher yield while maintaining eukaryotic processing

    • Avoid bacterial expression systems unless using specialized strains for membrane proteins

  • Vector and tag considerations:

    • Include a purification tag that doesn't interfere with the N-terminal hydrophobic domain

    • Consider inducible expression systems to mitigate potential toxicity

    • The tag type should be determined during the production process to optimize for the specific protein

  • Storage and stability:

    • Store in Tris-based buffer with 50% glycerol for stability

    • Maintain at -20°C for regular storage or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles; work with aliquots at 4°C for up to one week

  • Quality control metrics:

    • Verify protein identity by mass spectrometry or N-terminal sequencing

    • Assess purity by SDS-PAGE and size-exclusion chromatography

    • Confirm proper folding through activity assays or thermal shift assays

What analytical techniques are most appropriate for studying SRD5A3 in the context of the revised dolichol pathway?

Given the complexity of the newly discovered three-step dolichol synthesis pathway, researchers should employ:

  • Advanced mass spectrometry approaches:

    • Targeted LC-MS/MS for specific detection of pathway intermediates

    • Untargeted metabolomics to discover additional pathway components

    • Lipidomics to assess broader impacts on lipid metabolism

  • Imaging techniques:

    • Immunofluorescence microscopy to determine subcellular localization and potential co-localization with DHRSX

    • Live-cell imaging with fluorescent substrate analogs to track pathway dynamics

    • Super-resolution microscopy to analyze membrane microdomain organization

  • Biochemical interaction studies:

    • Pull-down assays to identify protein-protein interactions between pathway components

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic analysis of substrate binding

  • Genetic approaches:

    • CRISPR/Cas9 edited cell lines to create precise mutations mimicking disease variants

    • Rescue experiments with wild-type and mutant proteins

    • Analysis of glycoprotein mobility shifts (e.g., LAMP2) as readouts for N-glycosylation defects

How can researchers effectively compare SRD5A3 function across different species?

Cross-species analysis of SRD5A3 function can provide valuable evolutionary and functional insights:

  • Comparative sequence analysis:

    • Align SRD5A3 sequences from various species (human, panda, mouse, yeast Dfg10)

    • Identify conserved domains, particularly around catalytic sites and cofactor binding regions

    • Map disease-causing mutations onto conserved regions to predict functional impact

  • Functional complementation studies:

    • Test whether Ailuropoda melanoleuca SRD5A3 can rescue defects in human or yeast models

    • Compare enzymatic activities of recombinant proteins from different species

    • Identify species-specific differences in substrate specificity or catalytic efficiency

  • Model organism approaches:

    • Compare phenotypes between SRD5A3-deficient mouse models and human patients

    • Study zebrafish models for retinal defects, as supported by DHDDS research

    • Utilize yeast models (Dfg10) for high-throughput pathway analysis

  • Evolutionary analysis:

    • Investigate the co-evolution of SRD5A3 and DHRSX across species

    • Examine whether the three-step dolichol synthesis pathway is conserved in simpler organisms

    • Consider how pathway complexity relates to glycosylation requirements across species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.