Recombinant Ailurus fulgens Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase subunit 2 (COX2 or MT-CO2) is a critical component of the mitochondrial respiratory chain, essential for energy metabolism in animals . In giant pandas (Ailuropoda melanoleuca), a species with a unique bamboo-based diet and low energy intake, COX2 plays a significant role . Recombinant forms of this protein are valuable for research, allowing scientists to study its structure, function, and evolution in detail.

Background on Cytochrome c Oxidase Subunit 2 (COX2)

COX2 is a subunit of the cytochrome c oxidase complex (Complex IV), the terminal enzyme in the electron transport chain . This enzyme catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing oxygen to water and generating a proton gradient across the mitochondrial membrane . This proton gradient drives ATP synthesis, providing the energy currency for cellular processes.

COX2 is a highly conserved protein, but variations in its sequence can provide insights into the evolutionary adaptations of different species . For example, studies on primate COX2 have revealed variations in amino acid replacement rates and specific amino acid substitutions that may affect enzyme kinetics .

Significance of COX2 in Giant Pandas (Ailurus fulgens)

The giant panda's adaptation to a low-energy bamboo diet makes its energy metabolism particularly interesting . Research has shown that the COX2 gene in giant pandas is highly conserved and may have evolved differently compared to other members of the Ursidae family . This suggests that the structure and function of giant panda COX2 might be related to the species' lower energy intake and slower movement .

4.1. Genetic Analysis

Studies have isolated, sequenced, and analyzed the COX2 DNA from giant pandas to understand its genetic characteristics . These analyses have identified point mutations defining different haplotypes and revealed that the COX2 gene is conserved throughout evolution .

4.2. Phylogenetic Analysis

Phylogenetic analyses using COX2 sequences from giant pandas and other Ursidae species have shown that giant panda COX2 sequences cluster together, indicating a distinct evolutionary path . This divergence may be linked to the unique metabolic adaptations of giant pandas.

4.3. Functional Implications

The conserved structure and function of COX2 in giant pandas suggest its importance in maintaining energy metabolism despite a low-energy diet . Further research is needed to fully understand the functional implications of the unique characteristics of giant panda COX2.

Recombinant Production and Applications

Producing recombinant Ailurus fulgens COX2 allows for detailed biochemical and biophysical studies that would be difficult or impossible to perform with the native protein.

5.2. Functional Assays

Recombinant COX2 can be used in enzyme kinetics assays to measure its activity and determine how it is affected by mutations or inhibitors. These assays can help elucidate the role of specific amino acids in the protein's catalytic mechanism.

5.3. Evolutionary Studies

By comparing the sequence and structure of recombinant COX2 from different species, researchers can gain insights into the evolutionary history of the protein and how it has adapted to different metabolic needs.

Table: Comparison of Cytochrome c Oxidase Subunit II (COX2) in Different Species

FeatureGiant Panda (Ailuropoda melanoleuca)Other Ursidae SpeciesPrimates
DietBamboo-based, low-energyVariedVaried
Energy MetabolismAdapted to low-energy intakeNormalNormal
COX2 GeneConserved, unique haplotypesConservedHigher rate of amino acid replacement
Phylogenetic ClusteringDistinct cluster within UrsidaeVariesVaries
Functional ImplicationsMaintains metabolism on low energyNormal functionVaries

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Ailurus fulgens (Lesser panda) (Red panda)
Target Names
Target Protein Sequence
MAYPFQMGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTQELKPGELRLLEVDNRVVLPMELTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLELVPLSHFEKWSASLL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising three multi-subunit complexes (succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV)), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (heme a3 and CuB in subunit 1). This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the structural characteristics of Ailurus fulgens MT-CO2?

While the exact structure of Ailurus fulgens MT-CO2 has not been fully characterized, comparative analysis with other mammalian MT-CO2 proteins suggests it likely has:

  • A molecular weight of approximately 19-26 kDa

  • A transmembrane domain structure that anchors it in the inner mitochondrial membrane

  • A CuA binuclear center responsible for electron transfer from cytochrome c

  • Conserved amino acid residues critical for maintaining the protein's catalytic function

  • Post-translational modifications that regulate its stability and activity

Based on expression studies of other mammalian MT-CO2 proteins, the recombinant form is expected to have similar biochemical properties to the native protein, though potentially with altered glycosylation patterns depending on the expression system used.

What expression systems are most suitable for recombinant Ailurus fulgens MT-CO2 production?

Expression SystemAdvantagesLimitationsTypical Yield
E. coli- Cost-effective
- Rapid growth
- High protein yields
- Well-established protocols
- Lack of post-translational modifications
- Protein may form inclusion bodies
- Potential endotoxin contamination
10-50 mg/L culture
Insect cells- Proper folding
- Some post-translational modifications
- Higher solubility
- More expensive than bacterial systems
- Longer production time
- More complex protocols
5-20 mg/L culture
Mammalian cells- Native-like post-translational modifications
- Proper protein folding
- Functional confirmation
- Highest cost
- Most complex system
- Lowest yields
- Time-consuming
1-5 mg/L culture

For initial characterization studies, E. coli expression systems using vectors such as pET-32a have proven effective for recombinant mitochondrial proteins, with IPTG induction in Transetta (DE3) expression systems demonstrating reliable protein production . The addition of a 6-His tag facilitates purification via affinity chromatography, allowing for protein concentrations of approximately 50 μg/mL after optimization .

What cloning strategies should be employed for efficient expression of Ailurus fulgens MT-CO2?

When cloning Ailurus fulgens MT-CO2, researchers should consider several strategic approaches:

  • Codon optimization: Adjusting the codon usage to match the expression host (particularly important for E. coli systems) can significantly improve translation efficiency and yield. Since mitochondrial genes often have different codon usage patterns than nuclear genes, this step is critical.

  • Signal sequence modification: Removal of the mitochondrial targeting sequence and addition of appropriate signal peptides for the chosen expression system will improve proper localization and processing of the recombinant protein.

  • Fusion tag selection: Consider using a combination of tags that facilitate both detection and purification:

    • Solubility enhancers (SUMO, Thioredoxin, GST) to prevent inclusion body formation

    • Affinity tags (6×His, Strep-tag II) for efficient purification

    • Cleavable linkers to remove tags after purification if necessary

  • Vector selection: pET series vectors (particularly pET-32a) have proven effective for MT-CO2 expression, allowing for controlled induction and high-level protein production .

The full-length cDNA should include the complete open reading frame, which for mammalian MT-CO2 proteins typically encodes approximately 220-230 amino acid residues .

How can the enzymatic activity of recombinant Ailurus fulgens MT-CO2 be assessed?

The assessment of enzymatic activity is essential for verifying that the recombinant protein retains its native function:

  • Cytochrome c oxidation assay: Monitor the oxidation of reduced cytochrome c spectrophotometrically at 550 nm. The reaction rate provides a direct measure of MT-CO2 activity .

  • Oxygen consumption measurement: Using oxygen-sensitive electrodes or fluorescent probes to measure oxygen consumption rates in the presence of reduced cytochrome c and the recombinant MT-CO2.

  • Electron transfer kinetics: Stopped-flow spectroscopy can be employed to determine the rate constants for electron transfer between cytochrome c and the CuA center of MT-CO2.

  • Inhibitor binding studies: Evaluate interactions with known inhibitors (e.g., cyanide, azide) to confirm structural integrity of the active site.

UV-spectrophotometer analysis can confirm that the recombinant protein catalyzes the oxidation of substrate Cytochrome c, which serves as definitive evidence for functional activity . Additional infrared spectrometer analysis may provide insights into structural characteristics important for function.

What are common challenges in purifying recombinant Ailurus fulgens MT-CO2 and how can they be addressed?

ChallengeSolutionExpected Outcome
Inclusion body formation- Reduce expression temperature to 16-18°C
- Use solubility-enhancing fusion partners
- Add compatible solutes (glycerol, sorbitol) to culture medium
Increased proportion of soluble protein
Low affinity binding to purification resins- Optimize buffer conditions (pH, salt concentration)
- Test alternative tag positions (N vs. C-terminal)
- Use tandem affinity tags
Higher purity and yield after chromatography
Loss of copper cofactors- Supplement purification buffers with trace copper
- Avoid strong chelating agents
- Perform reconstitution after purification
Maintenance of catalytic activity
Protein instability- Include protease inhibitors throughout purification
- Optimize storage buffer with stabilizing agents
- Store at -80°C with cryoprotectants
Extended shelf-life and maintained activity

Affinity chromatography using Ni²⁺-NTA agarose has been successfully employed for purification of His-tagged recombinant MT-CO2 proteins, with Western blotting confirming the expected molecular weight . Optimizing elution conditions is critical to maintain protein stability while maximizing purity.

How can molecular docking be used to study interactions between Ailurus fulgens MT-CO2 and potential binding partners?

Molecular docking represents a powerful computational approach to predict protein-ligand interactions:

  • Structure preparation: Begin with a high-quality homology model of Ailurus fulgens MT-CO2 based on closely related species. Refine the model focusing on the CuA active site and potential binding pockets.

  • Ligand preparation: Generate appropriate 3D structures for potential binding partners, including substrates, inhibitors, or small molecule modulators. Ensure proper charge states and stereochemistry.

  • Docking protocol:

    • Define the binding site based on known functional domains

    • Employ flexible docking algorithms that account for protein side-chain movements

    • Use scoring functions that incorporate electrostatic, van der Waals, and desolvation energy terms

    • Perform ensemble docking with multiple protein conformations to account for dynamics

  • Analysis of results:

    • Identify key binding residues and interaction types (hydrogen bonds, hydrophobic interactions)

    • Calculate binding free energies to rank ligand affinities

    • Validate predictions with site-directed mutagenesis experiments

Previous molecular docking studies with related MT-CO2 proteins have successfully identified specific amino acid residues involved in ligand interactions, such as the formation of hydrogen bonds between a sulfur atom and Leu-31 residue in the case of allyl isothiocyanate (AITC) binding . These findings provide a foundation for structure-based drug design and functional studies targeting Ailurus fulgens MT-CO2.

What site-directed mutagenesis approaches are most effective for studying structure-function relationships in Ailurus fulgens MT-CO2?

Site-directed mutagenesis offers critical insights into structure-function relationships:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignment

    • Residues within the CuA binding site

    • Residues implicated in disease-associated mutations in other species

    • Potential post-translational modification sites

    • Residues identified in molecular docking studies as interaction partners

  • Mutation design considerations:

    • Conservative substitutions to probe specific chemical properties

    • Alanine scanning to identify essential residues

    • Incorporation of non-canonical amino acids for specialized functional probes

    • Disease-mimicking mutations to investigate pathogenic mechanisms

  • Validation approach:

    • Enzymatic activity assays comparing wild-type and mutant proteins

    • Thermal stability measurements to assess structural integrity

    • Spectroscopic analysis of copper coordination

    • Binding affinity determinations for interaction partners

  • Data interpretation:

    • Correlation of structural changes with functional outcomes

    • Identification of allosteric networks within the protein

    • Mechanistic insights into electron transfer pathways

Mutations in the MT-CO2 gene have been linked to cardiovascular disease and adult-onset cerebellar ataxia in humans , suggesting that homologous positions in Ailurus fulgens MT-CO2 may be particularly informative for understanding both normal function and disease mechanisms.

How can recombinant Ailurus fulgens MT-CO2 be utilized for comparative studies of mitochondrial evolution across mammalian species?

Recombinant Ailurus fulgens MT-CO2 provides an excellent model for evolutionary studies:

  • Phylogenetic analysis methodology:

    • Multiple sequence alignment of MT-CO2 sequences from diverse mammalian clades

    • Selection of appropriate evolutionary models based on AIC/BIC criteria

    • Construction of maximum likelihood and Bayesian phylogenetic trees

    • Calculation of site-specific evolutionary rates and selection pressures

  • Functional comparative approach:

    • Expression of recombinant MT-CO2 from multiple species using identical systems

    • Standardized activity assays under varying temperature and pH conditions

    • Substrate specificity comparisons across lineages

    • Inhibitor sensitivity profiling to identify functional divergence

  • Structural comparative analysis:

    • Homology modeling of MT-CO2 from multiple species

    • Quantification of structural conservation in functional domains

    • Identification of lineage-specific structural adaptations

    • Correlation of structural differences with habitat and metabolic demands

  • Adaptive evolution investigation:

    • Analysis of non-synonymous to synonymous substitution ratios (dN/dS)

    • Identification of positively selected sites using branch-site models

    • Correlation of selection patterns with ecological parameters

    • Experimental validation of adaptive hypotheses through recombinant protein characterization

Multiple sequence alignment and phylogenetic analysis have previously demonstrated that MT-CO2 proteins show high sequence identity across insect species , and similar approaches can be applied to mammals to understand the evolutionary conservation and divergence of this critical mitochondrial protein in Ailurus fulgens relative to other mammalian lineages.

What are the most common causes of low expression yield for recombinant Ailurus fulgens MT-CO2 and how can they be resolved?

ProblemPotential CausesSolutions
Low mRNA transcription- Weak promoter activity
- Inefficient transcription termination
- Plasmid instability
- Optimize induction conditions (IPTG concentration, timing)
- Use strong, regulated promoters (T7, tac)
- Check plasmid integrity by sequencing
Poor translation efficiency- Codon bias
- Strong mRNA secondary structures
- Inefficient ribosome binding
- Implement codon optimization
- Optimize 5' UTR and ribosome binding site
- Co-express rare tRNAs using Rosetta or similar strains
Protein toxicity- Disruption of host membrane integrity
- Interference with host respiration
- Use tight expression control systems
- Reduce induction temperature to 16-18°C
- Use specialty strains designed for toxic protein expression
Protein degradation- Proteolytic cleavage
- Improper folding triggering degradation
- Use protease-deficient host strains
- Add protease inhibitors during extraction
- Optimize harvest timing

When expressing recombinant mitochondrial proteins like MT-CO2, optimizing the induction conditions is critical. Previous studies have successfully induced expression using IPTG in E. coli Transetta (DE3) expression systems . The addition of fusion partners like thioredoxin (from pET-32a vector) can significantly enhance solubility and stability of the recombinant protein.

How can researchers overcome challenges in functional characterization of recombinant Ailurus fulgens MT-CO2?

Functional characterization of recombinant MT-CO2 presents several challenges:

  • Reconstructing the native environment:

    • Incorporation into artificial membrane systems (liposomes, nanodiscs)

    • Co-expression or reconstitution with other cytochrome c oxidase subunits

    • Addition of proper lipid compositions that mimic the inner mitochondrial membrane

  • Addressing copper center integrity:

    • In vitro copper reconstitution protocols using Cu(II) salts under controlled redox conditions

    • Spectroscopic verification of proper copper incorporation (EPR, UV-Vis, resonance Raman)

    • Activity correlation with copper content quantification

  • Substrate delivery optimization:

    • Ensuring reduced cytochrome c availability in activity assays

    • Preventing auto-oxidation of cytochrome c during experiments

    • Establishing proper ratios of enzyme to substrate

  • Assay sensitivity enhancement:

    • Implementation of coupled enzyme assays for amplified signal detection

    • Utilization of fluorescent or chemiluminescent detection systems

    • Development of high-throughput compatible formats for mutant screening

UV-spectrophotometer analysis has been successfully employed to demonstrate that recombinant MT-CO2 proteins can catalyze the oxidation of cytochrome c substrate . Additional analytical techniques such as infrared spectrometry can provide valuable insights into the structural features that influence enzymatic activity.

How can recombinant Ailurus fulgens MT-CO2 contribute to conservation biology and genetic diversity assessment?

Recombinant MT-CO2 research offers unique opportunities for conservation applications:

  • Genetic diversity monitoring:

    • Development of PCR primers specific for Ailurus fulgens MT-CO2 for non-invasive sampling

    • Sequence analysis of MT-CO2 variants across wild populations

    • Correlation of genetic diversity with population health and habitat fragmentation

    • Creation of reference databases for monitoring genetic erosion over time

  • Functional consequences of genetic variation:

    • Expression of naturally occurring MT-CO2 variants as recombinant proteins

    • Comparative functional analysis to assess impact of polymorphisms

    • Thermal stability testing to evaluate climate change vulnerability

    • Metabolic efficiency comparisons between variant forms

  • Population history reconstruction:

    • Molecular clock analysis using MT-CO2 sequence data

    • Estimation of historical population sizes and bottleneck events

    • Identification of historical population structure and gene flow patterns

    • Integration with nuclear DNA markers for comprehensive population genetics

  • Wildlife forensics applications:

    • Development of species-specific MT-CO2 antibodies for tissue identification

    • Quantitative PCR assays for detecting Ailurus fulgens products in illegal wildlife trade

    • Establishment of reference standards using recombinant protein

As a mitochondrial gene, MT-CO2 serves as an excellent marker for matrilineal evolutionary history and can provide crucial information for conservation planning of this endangered species.

What potential does Ailurus fulgens MT-CO2 have for understanding mitochondrial disease mechanisms?

The study of recombinant Ailurus fulgens MT-CO2 offers insights into mitochondrial disease mechanisms:

  • Disease-associated mutation modeling:

    • Introduction of known pathogenic human MT-CO2 mutations into the Ailurus fulgens ortholog

    • Biochemical characterization of mutant proteins to assess functional impacts

    • Structural analysis to understand mechanistic basis of dysfunction

    • Cross-species comparison to identify compensatory mechanisms

  • Species-specific resistance mechanisms:

    • Identification of unique sequence or structural features in Ailurus fulgens MT-CO2

    • Investigation of potential protective adaptations against oxidative stress

    • Comparative susceptibility to inhibitors and toxins affecting mitochondrial function

    • Analysis of species-specific protein-protein interactions

  • Therapeutic development platforms:

    • Screening for compounds that restore function to mutant MT-CO2 proteins

    • Identification of allosteric modulators of MT-CO2 activity

    • Development of protein stabilization strategies

    • Testing of mitochondrial-targeted antioxidants

  • Aging and metabolism research:

    • Analysis of MT-CO2 modifications associated with aging

    • Investigation of species-specific longevity determinants

    • Characterization of metabolic efficiency across temperature ranges

    • Exploration of hibernation-related adaptations in protein function

Given that mutations in the COX2/MT-CO2 gene have been identified as risk factors for cardiovascular disease and adult-onset cerebellar ataxia in humans , comparative studies with recombinant Ailurus fulgens MT-CO2 may reveal important insights into pathogenic mechanisms and potential therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.