Recombinant Ailurus fulgens NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Ailurus fulgens (Lesser panda) (Red panda)
Target Names
Target Protein Sequence
MNLIMTLFINITLTSLLVLIAFWLPQLNIYTEKTSPYECGFDPMGSARMPFSMKFFLVAI TFLLFDLEIALLLPLPWATQTVNLTTMLTTALLLISLLAVSLAYEWTEKGLEWTE
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its functional role in mitochondrial biology?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a crucial component of Complex I in the mitochondrial electron transport chain with EC number 1.6.5.3. This protein is encoded by the mitochondrial genome and plays an essential role in cellular energy production through oxidative phosphorylation. In its functional state, MT-ND3 contributes to the transfer of electrons from NADH to ubiquinone (Coenzyme Q10), helping establish the proton gradient necessary for ATP synthesis. The protein forms part of the membrane-embedded hydrophobic domain of Complex I, which is critical for proton translocation across the inner mitochondrial membrane .

The complete amino acid sequence of Ailurus fulgens MT-ND3 consists of 115 amino acids, predominantly hydrophobic in nature, reflecting its integral membrane protein characteristics. The protein contains multiple transmembrane regions that are functionally critical for maintaining the structural integrity of Complex I .

How do mutations in MT-ND3 affect mitochondrial function?

Mutations in MT-ND3 can significantly impair mitochondrial function, often resulting in isolated Complex I deficiency. The critical nature of this protein is demonstrated by the severe clinical phenotypes associated with its mutations, including Leigh syndrome and dystonia. The 10197G>A mutation, for example, results in an alanine to threonine substitution (A47T) in a highly conserved domain of the ND3 subunit, disrupting Complex I activity .

The functional consequences of MT-ND3 mutations typically manifest as:

  • Reduced electron transfer efficiency within Complex I

  • Impaired proton pumping across the inner mitochondrial membrane

  • Increased electron leakage leading to enhanced reactive oxygen species (ROS) production

  • Decreased ATP synthesis

  • Altered mitochondrial membrane potential (ΔψΜ)

These disruptions to normal mitochondrial function can trigger cell death pathways, particularly in tissues with high energy demands such as the central nervous system, explaining the neurological manifestations of MT-ND3 mutations .

What are the unique characteristics of Ailurus fulgens MT-ND3 compared to other species?

Ailurus fulgens (red panda) MT-ND3 shares core functional domains with other mammalian species but exhibits specific evolutionary adaptations. With recent genomic evidence establishing that red pandas comprise two distinct species - Ailurus fulgens and Ailurus styani - the specific characteristics of MT-ND3 may vary between these closely related taxa .

Comparative sequence analysis reveals that while the catalytic regions remain highly conserved across species, there are species-specific variations in non-catalytic regions. These variations may reflect adaptations to different metabolic demands or environmental conditions. Studies of mitochondrial DNA in red pandas have shown distinct haplotype patterns that correlate with their geographic distribution and evolutionary history .

The conservation of critical functional domains of MT-ND3 across species underscores its fundamental importance in cellular respiration, while species-specific variations provide insights into evolutionary adaptation and divergence. Detailed phylogenetic analysis using mitochondrial markers, including MT-ND3, has contributed significantly to understanding red panda taxonomy and conservation genetics .

How can recombinant Ailurus fulgens MT-ND3 be used to investigate mitochondrial dysfunction in disease models?

Recombinant Ailurus fulgens MT-ND3 offers a valuable tool for investigating mitochondrial dysfunction in various disease models. Researchers can use this recombinant protein to:

  • Establish structure-function relationships: By comparing wild-type and mutant forms of MT-ND3, researchers can elucidate how specific amino acid changes affect protein conformation and Complex I assembly.

  • Evaluate electron transport kinetics: Using purified recombinant MT-ND3 in reconstituted systems allows for precise measurement of electron transfer rates and efficiency under controlled conditions.

  • Generate antibodies for detection and quantification: Recombinant MT-ND3 serves as an antigen for producing specific antibodies, enabling the detection and quantification of native MT-ND3 in tissue samples.

  • Develop cell-based assays: Introducing recombinant MT-ND3 into cellular models permits the assessment of its impact on mitochondrial function and cellular metabolism .

When studying neurodegenerative conditions associated with mitochondrial dysfunction, such as Alzheimer's disease, researchers can utilize recombinant MT-ND3 to investigate how variants like 10398A>G affect Complex I activity. This variant has been identified as an expression quantitative trait loci (eQTL) for MT-ND3, potentially influencing mitochondrial heteroplasmy patterns observed in brain tissue .

What methods are optimal for expressing and purifying functional recombinant MT-ND3?

Expressing and purifying functional recombinant MT-ND3 presents significant challenges due to its hydrophobic nature and involvement in a multi-subunit complex. Researchers should consider the following methodological approaches:

Expression Systems:

  • E. coli-based systems: While commonly used, these often require optimization with specialized strains designed for membrane protein expression

  • Baculovirus-insect cell systems: Superior for expressing mitochondrial proteins with proper folding and post-translational modifications

  • Mammalian cell expression: Provides the most native-like environment but with lower yield

Purification Strategies:

  • Detergent selection: Critical for extracting MT-ND3 while maintaining its native conformation

  • Affinity chromatography: Utilizing His-tag or other fusion tags for initial capture

  • Size exclusion chromatography: For removing aggregates and obtaining homogeneous protein preparations

  • Reconstitution into nanodiscs or liposomes: To maintain function in a membrane-like environment

Storage Considerations:
Based on optimal conditions for recombinant Ailurus fulgens MT-ND3, the protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended preservation. Repeated freeze-thaw cycles should be avoided, with working aliquots maintained at 4°C for up to one week .

How does MT-ND3 contribute to ROS generation and what are the implications for cellular redox homeostasis?

MT-ND3, as a component of Complex I, plays a significant role in mitochondrial reactive oxygen species (ROS) generation. Research has demonstrated that alterations in electron transfer efficiency through Complex I can lead to increased electron leakage and subsequent ROS production. This process has profound implications for cellular redox homeostasis and cell survival pathways.

The mechanisms by which MT-ND3 influences ROS generation include:

  • Altered electron transfer kinetics: Structural changes in MT-ND3 can affect the efficiency of electron transfer within Complex I, leading to increased electron leakage to oxygen.

  • Modulation of ubiquinone binding: MT-ND3 contributes to the formation of the ubiquinone binding pocket, and alterations can affect the Q-pool and subsequent ROS generation.

  • Impact on Complex I assembly: Mutations in MT-ND3 can disrupt Complex I assembly, resulting in dysfunctional electron transport and increased ROS production.

Studies have shown that manipulating the mitochondrial Q-pool through delivery of oxidized Coenzyme Q10 (ubidecarenone) can increase ROS generation with potential therapeutic applications. This enhanced ROS production is specifically associated with Complex II and mitochondrial glycerol-3-phosphate dehydrogenase (mGPDH), which have functional connections to the Q-pool .

Experimental data indicates that increased mitochondrial H₂O₂ production following ubidecarenone treatment is sufficient to disrupt cellular redox balance, as evidenced by increased oxidation of various cellular redox probes. This redox imbalance can lead to mitochondrial membrane depolarization and trigger regulated cell death pathways .

What techniques are recommended for assessing MT-ND3 heteroplasmy in tissue samples?

Analyzing MT-ND3 heteroplasmy in tissue samples requires sensitive and precise methodologies to detect and quantify varying proportions of wild-type and mutant mitochondrial DNA. Based on current research practices, the following techniques are recommended:

Next-Generation Sequencing (NGS):

  • Provides high-resolution detection of heteroplasmy levels

  • Enables identification of low-frequency variants (down to ~1%)

  • Allows simultaneous analysis of multiple mitochondrial genes

Digital Droplet PCR (ddPCR):

  • Offers absolute quantification without standard curves

  • Provides high sensitivity for detecting low-level heteroplasmy

  • Reduces PCR bias that can affect heteroplasmy estimation

Pyrosequencing:

  • Suitable for targeted analysis of known MT-ND3 variants

  • Provides accurate quantification in the 5-95% heteroplasmy range

  • Requires less sophisticated equipment than NGS

Research has demonstrated that MT heteroplasmy patterns can vary significantly between tissue types. For example, studies analyzing over 1800 whole genome sequencing datasets from Alzheimer's disease cohorts found that while MT heteroplasmy was present throughout the entire mitochondrial genome in blood samples, brain samples exhibited heteroplasmy primarily within the MT control region .

What functional assays can accurately measure MT-ND3 activity within Complex I?

Assessing the functional activity of MT-ND3 within Complex I requires specialized techniques that can measure both individual and integrated aspects of its function. The following methodological approaches are recommended:

Complex I Enzyme Activity Assays:

  • NADH:ubiquinone oxidoreductase activity: Measures the rate of NADH oxidation coupled to ubiquinone reduction

  • Site-specific inhibitor studies: Using rotenone to distinguish Complex I-specific activity from non-specific NADH oxidation

  • Diphenyleneiodonium (DPI) sensitivity: Evaluates flavin-dependent activities within Complex I

Mitochondrial Respiration Analysis:

  • High-resolution respirometry: Measures oxygen consumption rates in response to specific substrates

  • Substrate-dependent respiration: Compares respiration rates with NADH-generating substrates versus succinate

  • Inhibitor titration experiments: Determines the control coefficient of Complex I over respiration

ROS Production Measurement:

  • Hydrogen peroxide production: Using Amplex Red or similar fluorescent probes

  • Superoxide detection: Using mitochondria-targeted probes like MitoSOX

  • Site-specific ROS production: With inhibitors targeting different electron transport components

Mitochondrial Membrane Potential Assessment:

  • TMRE fluorescence: Measures membrane potential in active versus depolarized mitochondria

  • JC-1 fluorescence ratio: Provides ratiometric measurement of membrane polarization

  • Potential-dependent dye uptake kinetics: Assesses the dynamics of membrane potential changes

Research has shown that mitochondrial dysfunction associated with MT-ND3 variants can be assessed by examining membrane potential using lipophilic cation fluorescent dyes such as TMRE, which are sequestered in active (polarized) but not in inactive (depolarized) mitochondria. This approach provides valuable insights into the functional consequences of MT-ND3 alterations .

What cellular models are most appropriate for studying MT-ND3 function and dysfunction?

Selecting appropriate cellular models is crucial for studying MT-ND3 function and dysfunction. The following models offer distinct advantages for different research questions:

Cybrid Cell Lines:

  • Created by fusing ρ° cells (lacking mtDNA) with patient-derived mitochondria

  • Allow study of specific mtDNA mutations on a controlled nuclear background

  • Enable assessment of heteroplasmy effects on cellular function

  • Have been successfully used to demonstrate the transferability and pathogenicity of MT-ND3 mutations like 10197G>A

Patient-Derived Cell Lines:

  • Primary fibroblasts from patients with MT-ND3 mutations

  • Lymphoblastoid cell lines (LCLs) for studying variant effects on gene expression

  • Induced pluripotent stem cells (iPSCs) that can be differentiated into affected cell types

  • Studies have used LCLs to characterize the effects of MT-ND3 variants on gene expression patterns and MT heteroplasmy

3D Tissue Models:

  • Organoids derived from patient cells or engineered with specific mutations

  • Provide tissue-specific context for studying MT-ND3 dysfunction

  • Enable assessment of cell-cell interactions in disease pathogenesis

  • Patient-derived organoids have proven valuable for studying mitochondrial dysfunction

Animal Models:

  • Enables in vivo assessment of MT-ND3 dysfunction

  • Provides whole-organism physiological context

  • Allows for tissue-specific and developmental studies

  • Can incorporate reporter systems for monitoring mitochondrial function

When selecting cellular models, researchers should consider the specific aspects of MT-ND3 function being investigated, the experimental techniques to be employed, and the relevance to the disease or condition under study. For conservation-related research, cell lines derived from Ailurus fulgens provide valuable models for studying species-specific aspects of mitochondrial function .

How can MT-ND3 genetics contribute to conservation efforts for Ailurus fulgens?

MT-ND3 genetics provides valuable insights for Ailurus fulgens conservation, offering molecular tools for population assessment, genetic diversity monitoring, and taxonomic clarification. Recent genomic research has revolutionized our understanding of red panda taxonomy, confirming their classification into two distinct species: Ailurus fulgens (Himalayan red panda) and Ailurus styani (Chinese red panda) .

Mitochondrial DNA analysis, including MT-ND3 sequencing, offers several applications for red panda conservation:

  • Population Genetic Structure Analysis: Mitochondrial markers help identify genetically distinct populations requiring separate conservation management. Studies analyzing mtDNA control regions have revealed significant genetic differentiation corresponding to geographic distribution, supporting the two-species classification .

  • Demographic History Reconstruction: MT-ND3 and other mitochondrial genes can reveal historical population bottlenecks and expansions. Genomic evidence has revealed different demographic trajectories between the two red panda species - A. styani experienced two bottlenecks and one large expansion, while A. fulgens underwent three bottlenecks and only a small expansion, resulting in very low genetic diversity and high genetic load .

  • Genetic Health Assessment: MT-ND3 variants can indicate mitochondrial function and potential fitness implications. Monitoring these genetic markers helps assess population viability.

  • Forensic Applications: MT-ND3 sequencing can identify the species and potentially geographic origin of confiscated samples, aiding wildlife trafficking enforcement.

Conservation breeding programs benefit from MT-ND3 and other genetic analyses by enabling managers to:

  • Identify pure-species individuals for species-specific conservation breeding

  • Maintain appropriate genetic diversity within captive populations

  • Avoid inbreeding depression through informed mating decisions

  • Support potential reintroduction efforts with genetically appropriate individuals

What can comparative analysis of MT-ND3 across species reveal about evolutionary conservation of mitochondrial function?

Comparative analysis of MT-ND3 across species provides valuable insights into the evolutionary conservation of mitochondrial function and adaptation. MT-ND3, as a component of Complex I, represents a critical element of cellular energy production that has been subject to evolutionary pressures throughout animal phylogeny.

Key findings from comparative analyses include:

  • Functional Domain Conservation: The catalytic regions of MT-ND3 show remarkable conservation across diverse species, indicating strong selective pressure to maintain fundamental aspects of electron transport. This conservation is particularly evident in transmembrane domains and residues involved in ubiquinone interaction.

  • Species-Specific Adaptations: Despite core functional conservation, MT-ND3 exhibits species-specific variations, particularly in regions not directly involved in electron transport. These variations may represent adaptations to different metabolic demands, environmental conditions, or co-evolution with nuclear-encoded Complex I subunits.

  • Pathogenic Mutation Hotspots: Comparative analysis reveals certain regions of MT-ND3 as hotspots for pathogenic mutations across species. For example, the region containing the A47T mutation (10197G>A) associated with Leigh syndrome in humans corresponds to a highly conserved domain across mammals, including Ailurus fulgens .

  • Evolutionary Rate Variation: The evolutionary rate of MT-ND3 varies across lineages, potentially reflecting differences in selective pressures or metabolic requirements. Analysis of synonymous versus non-synonymous substitution rates provides insights into the strength and direction of selection.

The MT variant 10398A>G (rs2853826), which functions as an expression quantitative trait loci (eQTL) for MT-ND3, has been linked with the largest number of distinct disease phenotypes among all annotated MT variants in MitoMap. This suggests that certain regions of MT-ND3 may have pleiotropic effects that influence multiple physiological systems .

Comparative genomic approaches using MT-ND3 and other mitochondrial genes have contributed significantly to resolving taxonomic uncertainties, as demonstrated in the reclassification of red pandas into two distinct species based on genetic evidence that included mitochondrial DNA analysis .

What methodological approaches are recommended for analyzing MT-ND3 variation in endangered species?

Analyzing MT-ND3 variation in endangered species like Ailurus fulgens requires specialized methodological approaches that maximize data quality while minimizing impact on vulnerable populations. The following techniques are recommended for comprehensive assessment of MT-ND3 variation in conservation contexts:

Non-invasive Sampling Techniques:

  • Fecal DNA collection allows genetic analysis without animal capture

  • Hair samples from natural rub sites or strategic hair traps

  • Environmental DNA (eDNA) from habitat areas

  • Museum specimens and historical samples for temporal comparisons

These approaches are particularly important for elusive, stress-sensitive species like red pandas, where minimizing disturbance is critical .

Amplification and Sequencing Strategies:

  • Whole mitochondrial genome sequencing: Provides comprehensive data but requires higher DNA quality

  • Targeted MT-ND3 amplification: More successful with degraded samples from non-invasive sources

  • Long-range PCR followed by next-generation sequencing: Reduces nuclear pseudogene amplification

  • Metabarcoding approaches: For simultaneous analysis of multiple species from environmental samples

Data Analysis Frameworks:

  • Phylogenetic analysis: For resolving taxonomic relationships and evolutionary history

  • Population genetic analyses: To assess genetic structure and diversity

  • Demographic modeling: To reconstruct historical population changes

  • Selection analysis: To identify functionally important variation

Research teams studying red panda genetics have successfully employed these approaches to collect and analyze mtDNA control region (CR) sequences across the species' range. By combining data from multiple studies and sampling locations, researchers have created more comprehensive phylogeographic assessments that support species delineation and conservation prioritization .

Sampling ApproachAdvantagesLimitationsApplication in Red Panda Research
Fecal DNANon-invasive, abundant, contains host and dietary DNALower DNA quality, contamination riskSuccessfully used to collect mtDNA data across geographic range
Hair SamplesHigher DNA quality than fecal, non-invasiveLimited quantity, collection challengesUseful for supplementing fecal DNA studies
Tissue SamplesHighest DNA qualityInvasive, requires captureLimited use, primarily from veterinary procedures or mortalities
Museum SpecimensHistorical perspective, no impact on living populationDNA degradation, limited quantityValuable for establishing historical baselines and temporal trends

When analyzing MT-ND3 in endangered species, researchers should carefully weigh methodological choices against conservation priorities, selecting approaches that provide necessary data while minimizing impact on vulnerable populations .

How might CRISPR-Cas9 mitochondrial gene editing advance MT-ND3 functional studies?

Mitochondrial gene editing using CRISPR-Cas9 technology represents a promising frontier for MT-ND3 functional studies, though it presents unique challenges compared to nuclear genome editing. Recent advances are beginning to overcome these obstacles, potentially revolutionizing our understanding of MT-ND3 function and dysfunction.

Key approaches and applications include:

  • Mitochondrially-targeted nucleases: Novel delivery systems using mitochondrial targeting sequences can transport CRISPR-Cas9 components to mitochondria for precise MT-ND3 editing.

  • Base editing technologies: Mitochondrial cytosine and adenine base editors enable precise nucleotide substitutions without double-strand breaks, allowing researchers to introduce specific MT-ND3 variants of interest.

  • Heteroplasmy manipulation: Selective targeting of mutant mtDNA copies could shift heteroplasmy levels, providing insights into threshold effects of MT-ND3 mutations like the 10197G>A mutation associated with Leigh syndrome .

  • Rescue experiments: Introducing wild-type MT-ND3 sequences can potentially rescue mitochondrial dysfunction in cells carrying pathogenic mutations, establishing causality between specific variants and phenotypes.

  • Conservation applications: Genetic rescue techniques might eventually be applied to address low genetic diversity in endangered populations, such as Ailurus fulgens populations that have experienced historical bottlenecks .

Potential research applications include:

  • Creating isogenic cell lines differing only in MT-ND3 sequence to eliminate confounding genetic factors

  • Introducing variants of unknown significance to assess their functional impact

  • Studying the effect of heteroplasmy levels on cellular phenotypes

  • Investigating potential therapeutic approaches for mitochondrial disorders

While technical challenges remain, these emerging technologies promise to significantly advance our understanding of MT-ND3 function in both basic research and conservation contexts.

What role might MT-ND3 play in adaptive responses to environmental stressors?

MT-ND3, as a critical component of mitochondrial Complex I, likely plays a significant role in adaptive responses to environmental stressors. Understanding these roles has implications for both human health and wildlife conservation, particularly for species like Ailurus fulgens facing habitat challenges.

Potential adaptive mechanisms involving MT-ND3 include:

  • Metabolic flexibility: MT-ND3 variants may influence the efficiency of NADH oxidation, potentially allowing adaptation to different energy substrates or metabolic demands under environmental stress.

  • Thermal adaptation: MT-ND3 modifications could affect Complex I efficiency at different temperatures, potentially contributing to adaptation to climate variation or extremes.

  • Hypoxia response: In low-oxygen environments, MT-ND3 variants may influence electron transport efficiency and ROS production, potentially affecting cellular adaptation to hypoxic conditions.

  • Oxidative stress management: Variations in MT-ND3 structure might affect electron leakage and subsequent ROS generation, influencing how cells manage oxidative stress from environmental toxins or physiological challenges.

Research has shown that mitochondrial genes, including MT-ND3, can exhibit functional adaptations to environmental conditions. For example, the different demographic histories observed between Ailurus fulgens and Ailurus styani may reflect, in part, adaptations to different ecological niches and historical environmental challenges .

The MT variant 10398A>G, which functions as an expression quantitative trait loci (eQTL) for MT-ND3, has been linked to various disease phenotypes, suggesting that MT-ND3 expression levels may influence adaptive responses to physiological stress . Similarly, in plant systems, alternative NADH:ubiquinone oxidoreductase has been identified as a susceptibility factor in pathogen responses, demonstrating how this class of enzymes can influence stress adaptation .

Further research into MT-ND3 variation across Ailurus fulgens populations from different habitats and elevations could provide valuable insights into its potential role in local adaptation and response to climate change.

How might understanding MT-ND3 contribute to developing mitochondrial therapeutics?

Understanding MT-ND3 structure, function, and dysfunction could significantly contribute to developing mitochondrial therapeutics for both human diseases and wildlife conservation. Several promising approaches leverage MT-ND3 insights:

Therapeutic Approaches Based on MT-ND3 Research:

  • Small molecule modulators: Compounds that bind to specific regions of MT-ND3 could potentially stabilize dysfunctional proteins or enhance electron transfer efficiency in mutant forms.

  • Redox modulators: Understanding how MT-ND3 variants influence ROS production enables the development of targeted antioxidant strategies. Research has demonstrated that manipulating the mitochondrial Q-pool can modulate ROS generation with potential therapeutic effects .

  • Gene therapy approaches: Although challenging due to the mitochondrial genetic system, advances in mitochondrial gene delivery could eventually enable replacement of dysfunctional MT-ND3 genes.

  • Heteroplasmy shifting therapies: Techniques to selectively eliminate mutant mtDNA or enhance replication of wild-type mtDNA could address MT-ND3 mutations with heteroplasmic distribution, such as the 10197G>A mutation associated with Leigh syndrome .

  • Metabolic bypass strategies: Understanding the specific biochemical consequences of MT-ND3 dysfunction enables the development of metabolic interventions that bypass or compensate for Complex I deficiency.

For conservation applications, these approaches could potentially address genetic health concerns in endangered populations like Ailurus fulgens, which has experienced multiple population bottlenecks resulting in very low genetic diversity, high linkage disequilibrium, and high genetic load .

Research has already demonstrated that delivery of oxidized Coenzyme Q10 (ubidecarenone) to increase the mitochondrial Q-pool can induce ROS-mediated effects with therapeutic potential. This mechanism involves the functional connection between the Q-pool and Complex I, where MT-ND3 plays a critical role .

The development of mitochondrial therapeutics based on MT-ND3 research represents a promising frontier for addressing both human mitochondrial disorders and genetic health challenges in endangered species conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.