Recombinant Ajellomyces capsulata Assembly factor CBP4 (CBP4)

Shipped with Ice Packs
In Stock

Description

Taxonomic Classification

Ajellomyces capsulata Assembly factor CBP4 is a protein encoded by the CBP4 gene found in Ajellomyces capsulata, which is the teleomorph (sexual reproductive stage) of the pathogenic fungus Histoplasma capsulatum . The protein is classified under assembly factors with specific functions related to cytochrome b mRNA processing, as indicated by its full name: Cytochrome b mRNA-processing protein 4 . This taxonomic relationship is significant as it places the protein within the context of a clinically relevant fungal pathogen.

Relationship to Histoplasma capsulatum

Histoplasma capsulatum, whose teleomorph is known as Ajellomyces capsulatus, is a dimorphic fungus that causes histoplasmosis in humans and animals . The fungus has three variants: var. capsulatum, var. duboissii, and var. farciminosum . The relationship between Ajellomyces capsulata and Histoplasma capsulatum has been confirmed through molecular and phylogenetic studies, which have demonstrated that isolates from various geographical regions and hosts (including humans and animals) belong to the same phylogenetic clade . This biological context is essential for understanding the potential significance of the CBP4 protein in pathogenicity.

Recombinant Expression Methodologies

Recombinant Ajellomyces capsulata Assembly factor CBP4 is primarily produced using bacterial expression systems, with Escherichia coli being the predominant host organism . The recombinant protein is typically fused with an N-terminal histidine tag (His-tag) to facilitate purification and downstream applications . This expression approach yields a protein product that maintains the structural and functional properties of the native protein while providing additional features for research applications.

Purification and Quality Assessment

The recombinant protein undergoes rigorous purification processes to achieve high purity levels, typically greater than 85-90% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . The purified protein is usually formulated as a lyophilized powder in a buffer containing trehalose to maintain stability during storage and shipping . This formulation approach ensures that the protein maintains its structural integrity and functional properties for research applications.

Table 1: Production Specifications of Recombinant Ajellomyces capsulata CBP4

ParameterSpecificationSource
Expression SystemE. coli
Protein LengthFull Length (1-116 amino acids)
Fusion TagN-terminal His-tag
Physical FormLyophilized powder
Purity>85-90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Cellular Functions

The CBP4 protein functions as an assembly factor involved in cytochrome b mRNA processing . While specific functional studies on the Ajellomyces capsulata variant are not extensively detailed in the search results, the protein's classification as an assembly factor suggests its involvement in the biogenesis and assembly of cytochrome complexes, which are essential for cellular respiration and energy metabolism in fungal cells.

Potential Role in Fungal Pathogenicity

Given that Ajellomyces capsulata is the teleomorph of Histoplasma capsulatum, a significant fungal pathogen, the CBP4 protein may have implications for pathogenicity and virulence . Histoplasma capsulatum causes histoplasmosis, which can manifest as various clinical forms including pulmonary infections and systemic disease . Understanding the function of proteins like CBP4 in this organism may provide insights into its survival strategies and pathogenic mechanisms.

Immunological and Diagnostic Applications

Recombinant Ajellomyces capsulata CBP4 has potential applications in immunological research and diagnostic development. The availability of purified recombinant protein enables the development of antibodies and immunoassays that can be used to study the expression and localization of this protein in fungal cells, potentially contributing to diagnostic approaches for histoplasmosis.

Reconstitution Protocols

The lyophilized protein should be briefly centrifuged prior to opening to bring contents to the bottom of the vial. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and aliquot the reconstituted protein before storing at -20°C or -80°C . These handling protocols ensure the maintenance of protein quality and activity for research applications.

Table 2: Storage and Handling Recommendations

ParameterRecommendationNotes
Long-term Storage-20°C/-80°CAliquoting necessary for multiple use
Short-term Storage4°CUp to one week for working aliquots
Reconstitution MediumDeionized sterile waterTo 0.1-1.0 mg/mL concentration
Storage Additive5-50% glycerolDefault recommendation: 50%
PrecautionsAvoid repeated freeze-thaw cyclesCentrifuge vial before opening

Homology with Other Fungal CBP4 Proteins

Comparative analysis reveals similarities between Ajellomyces capsulata CBP4 and homologous proteins from other fungal species, such as Meyerozyma guilliermondii . The Meyerozyma guilliermondii CBP4 protein consists of 143 amino acids and shares functional classifications with the Ajellomyces variant, suggesting evolutionary conservation of this protein family across fungal lineages . This conservation indicates the fundamental importance of CBP4 in fungal cellular processes.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requests. Please clearly indicate your desired format in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance and be aware that additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products can be influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that specified tag.
Synonyms
CBP4; HCAG_05078; Assembly factor CBP4; Cytochrome b mRNA-processing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
CBP4
Target Protein Sequence
MPRIGTTVKMIVAGVLLCIGGPALVQYVRPTEEELFQKFNPELQKRNLETRDQRQKDFDS FVTQLKTHAKSDKSIWHAIKESETTNRREVETRRKAELEEAERQKAQIRKELAEGS
Uniprot No.

Target Background

Function
Assembly factor CBP4 (CBP4) is essential for the assembly of ubiquinol-cytochrome c reductase. It plays a direct role in ensuring the correct formation of the Rieske protein, core 4, core 5, and apocytochrome b.
Database Links
Protein Families
CBP4 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Ajellomyces capsulata and its relationship to Histoplasma capsulatum?

Ajellomyces capsulata is the teleomorph (sexual reproductive stage) of Histoplasma capsulatum, as noted in taxonomic classifications . This dimorphic fungal pathogen exists in both mycelial and yeast forms, with the latter being the pathogenic form found in host tissues. H. capsulatum causes histoplasmosis, a significant fungal infection that can present in various clinical forms ranging from asymptomatic to severe disseminated disease . The organism grows in mycelial form at temperatures below 35°C but converts to yeast form at higher temperatures (>35°C), particularly within host tissues . This dimorphic capability is critical to its pathogenicity and environmental persistence.

What is the primary function of CBP4 in Ajellomyces capsulata?

CBP4 serves dual essential functions in Ajellomyces capsulata. Primarily, it functions as an assembly factor involved in cytochrome b mRNA processing, making it a key component for maintaining proper mitochondrial function and energy production in the pathogen. Additionally, CBP4 demonstrates calcium-binding properties that are essential for fungal growth under calcium-limiting conditions, which are commonly encountered during host infection. This calcium-binding capability enables the fungus to maintain metabolic processes even when host defense mechanisms attempt to restrict available calcium. Knockout studies have demonstrated that CBP4 is required for survival in murine infection models, confirming its role as a virulence factor.

How does CBP4 contribute to fungal pathogenesis?

CBP4 contributes to fungal pathogenesis through multiple mechanisms:

  • Mitochondrial energy maintenance: As an assembly factor for cytochrome b processing, CBP4 ensures proper electron transport chain function, which is critical for cellular energy production during infection.

  • Calcium homeostasis: By binding calcium in calcium-restricted environments (such as within phagolysosomes), CBP4 helps the fungus maintain essential metabolic processes despite host defense mechanisms.

  • Macrophage evasion: CBP4 participates in mechanisms that allow H. capsulatum to evade destruction by macrophages, converting these host defense cells into a protected environment for fungal replication.

  • Adaptation to host microenvironments: The protein facilitates fungal adaptation to varying conditions encountered during infection progression.

These combined functions make CBP4 essential for virulence, as demonstrated by attenuation of pathogenicity in knockout models.

What are the optimal conditions for handling recombinant CBP4 protein?

For optimal handling of recombinant CBP4:

  • Reconstitution: Dissolve in sterile water at concentrations of 0.1-1.0 mg/mL, supplemented with 5-50% glycerol to maintain long-term stability.

  • Storage: Store in small aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity.

  • Working conditions: Based on related fungal proteins, optimal activity is typically maintained at physiological pH (7.0-7.4) and temperatures between 25-37°C for experimental procedures.

  • Cofactor requirements: Ensure calcium availability in experimental buffers, as calcium binding is critical for protein function.

  • Stability considerations: Minimize exposure to proteases and oxidizing agents that may compromise structural integrity and functional capacity.

What approaches are most effective for studying CBP4 interactions with host immune components?

When investigating CBP4 interactions with host immune components, several methodological approaches have proven effective:

  • Protein-protein interaction assays: Techniques such as co-immunoprecipitation, yeast two-hybrid screening, and proximity ligation assays can identify direct binding partners of CBP4 within host cells. Similar approaches have been successful with other H. capsulatum surface proteins like Hsp60, which was shown to interact with CR3 integrin receptors on macrophages .

  • Fluorescence microscopy: Immunofluorescence labeling of CBP4 combined with confocal microscopy allows visualization of protein localization during host-pathogen interactions. This approach revealed that Hsp60 clusters on the cell wall of H. capsulatum , and similar techniques would be valuable for CBP4 localization studies.

  • Flow cytometry-based binding assays: These can quantitatively assess CBP4 interactions with immune cell receptors under varying conditions. Such methodologies demonstrated that antibodies binding histone 2B-like protein on H. capsulatum enhanced phagocytosis through CR3-dependent processes .

  • Live-cell calcium imaging: Since CBP4 functions in calcium-binding, calcium flux experiments using fluorescent indicators can reveal how the protein influences calcium dynamics during host-pathogen interactions.

  • Knockout/complementation studies: Generating CBP4-deficient strains and complemented controls enables assessment of its specific contributions to immune evasion mechanisms.

How can researchers effectively design CBP4 knockout studies to assess virulence attenuation?

Effective design of CBP4 knockout studies requires careful consideration of multiple methodological aspects:

  • Gene targeting strategy:

    • Employ CRISPR-Cas9 or homologous recombination approaches targeting the CBP4 gene locus

    • Create conditional knockouts using tetracycline-regulated systems to control gene expression temporally

    • Generate complemented strains to confirm phenotype specificity

  • Verification methods:

    • Confirm gene deletion via PCR, RT-qPCR, and Western blotting

    • Assess mitochondrial cytochrome b processing to confirm functional knockout

    • Evaluate calcium binding capacity using radioisotope or fluorescence-based assays

  • Virulence assessment models:

    • In vitro macrophage infection assays comparing wild-type and knockout strains

    • Murine pulmonary infection models with assessment of fungal burden in lungs and dissemination

    • Survival studies in normal and immunocompromised mouse models

    • Comparative histopathology examining tissue damage patterns

  • Downstream analysis:

    • RNA-seq to identify compensatory pathways activated in knockout strains

    • Metabolomic analysis to identify altered metabolic profiles

    • Mitochondrial function assays (oxygen consumption, ATP production)

Previous knockout studies of H. capsulatum virulence factors have shown that such comprehensive approaches can effectively link specific proteins to pathogenicity mechanisms.

What methodological considerations are important when studying CBP4's role in mitochondrial function?

When investigating CBP4's role in mitochondrial function, researchers should consider:

  • Subcellular fractionation techniques:

    • Implement differential centrifugation to isolate intact mitochondria

    • Verify fraction purity using mitochondrial markers (e.g., cytochrome c oxidase)

    • Maintain sample integrity with appropriate protease inhibitors and cold conditions

  • Functional assays:

    • Measure oxygen consumption rates using high-resolution respirometry

    • Assess membrane potential using potentiometric dyes (TMRM, JC-1)

    • Quantify ATP production under various conditions

    • Evaluate reactive oxygen species production

  • mRNA processing analysis:

    • Northern blot analysis to assess cytochrome b mRNA processing

    • RNA-seq to identify global impacts on mitochondrial transcript processing

    • Pulse-chase labeling to track newly synthesized mitochondrial proteins

  • Protein-RNA interaction studies:

    • RNA immunoprecipitation to identify direct RNA targets

    • EMSA (electrophoretic mobility shift assay) to confirm binding specificity

    • RNA structure probing to identify binding regions

  • Comparative analysis:

    • Cross-species comparison with homologs in model organisms

    • Assessment under various stress conditions (oxidative, temperature, nutrient)

The investigation methodology should account for the dimorphic nature of H. capsulatum, as mitochondrial function may differ between yeast and mycelial forms, similar to how heat shock protein expression varies between these morphotypes .

What are the recommended approaches for studying calcium-binding properties of CBP4?

To comprehensively investigate the calcium-binding properties of CBP4, researchers should employ:

  • Biophysical characterization techniques:

    • Isothermal titration calorimetry (ITC) to determine binding constants and thermodynamic parameters

    • Circular dichroism spectroscopy to assess calcium-induced conformational changes

    • Fluorescence spectroscopy utilizing intrinsic tryptophan fluorescence or extrinsic probes

    • Surface plasmon resonance for real-time binding kinetics

  • Structural biology approaches:

    • X-ray crystallography of CBP4 in calcium-bound and unbound states

    • NMR spectroscopy to map calcium binding sites and detect conformational dynamics

    • Hydrogen-deuterium exchange mass spectrometry to identify regions affected by calcium binding

  • Functional assays:

    • Calcium depletion growth studies comparing wild-type and CBP4-mutant strains

    • Radioactive 45Ca2+ binding assays to quantify binding capacity

    • Competition assays with other divalent cations to assess binding specificity

    • Calcium flux measurements using fluorescent indicators in live cells

  • Mutational analysis:

    • Site-directed mutagenesis of predicted calcium-binding residues

    • Creation of truncation mutants to identify minimal binding domains

    • Domain-swapping experiments with other calcium-binding proteins

  • In silico approaches:

    • Molecular dynamics simulations to predict calcium coordination

    • Homology modeling based on known calcium-binding proteins

    • Sequence analysis for EF-hand or other calcium-binding motifs

How does CBP4 compare to other virulence factors in Histoplasma capsulatum?

CBP4 shares functional similarities with other H. capsulatum virulence factors while maintaining distinct mechanisms:

Virulence FactorPrimary FunctionCellular LocalizationKnockout PhenotypeContribution to Pathogenesis
CBP4Calcium binding, mitochondrial assemblyMitochondria, possibly surfaceReduced survival in murine modelsCalcium homeostasis, energy production, macrophage evasion
Hsp60Molecular chaperoneCell wall, cytoplasm, vesiclesLethal (essential gene)Macrophage binding via CR3, immunomodulation
Hsp70Chaperone, stress responseCell surface, secreted in vesiclesReduced virulenceStress adaptation, possible immunomodulation
Histone 2B-likeChromatin organization, surface bindingNucleus, cell surfaceReduced virulenceTarget for protective antibody responses

Unlike surface-exposed heat shock proteins (Hsp60, Hsp70) that primarily mediate host cell interactions and immunomodulation , CBP4's contributions to virulence center on maintaining metabolic function under stress conditions and calcium-limited environments, representing a distinct virulence strategy.

What experimental challenges are specific to working with CBP4 compared to other H. capsulatum proteins?

Researchers working with CBP4 face several unique experimental challenges:

  • Dual localization complexities: Unlike exclusively surface-exposed proteins like Hsp60 , CBP4's potential presence in both mitochondria and possibly other locations requires specialized fractionation techniques to study compartment-specific functions.

  • Calcium-dependent activity: Experimental buffers must be carefully formulated to control calcium concentrations, as both excess and insufficient calcium can affect protein function and experimental outcomes.

  • Mitochondrial targeting: Recombinant expression systems must account for mitochondrial targeting sequences and potential post-translational modifications required for proper localization and function.

  • Functional redundancy: Other calcium-binding proteins may compensate for CBP4 deficiency in knockout studies, necessitating multiple gene targeting approaches.

  • mRNA processing assessment: Evaluating cytochrome b mRNA processing requires specialized RNA analysis techniques that are more complex than typical protein-protein interaction studies.

  • Dimorphic considerations: Unlike some H. capsulatum virulence factors with consistent expression, CBP4 function may vary between yeast and mycelial forms, requiring parallel studies in both morphotypes.

  • Structural complexity: If CBP4 forms part of larger protein complexes, as suggested by its assembly factor role, protein purification for structural studies becomes more challenging than for autonomous proteins.

How can researchers distinguish between direct and indirect effects of CBP4 on fungal virulence?

Distinguishing direct from indirect effects of CBP4 on virulence requires strategic experimental approaches:

  • Temporal control systems:

    • Implement inducible/repressible expression systems (e.g., tetracycline-regulated)

    • Monitor immediate vs. delayed phenotypic changes following CBP4 modulation

    • Employ time-course transcriptomic/proteomic analyses to identify primary and secondary responses

  • Domain-specific mutants:

    • Generate point mutations affecting specific functions (e.g., calcium binding vs. mRNA processing)

    • Create chimeric proteins with domains from non-pathogenic homologs

    • Assess which functional domains correlate with specific virulence phenotypes

  • Epistasis studies:

    • Create double-knockout strains with CBP4 and other virulence factors

    • Determine additive, synergistic, or redundant relationships

    • Identify dependency relationships in virulence pathways

  • Cellular localization manipulation:

    • Redirect CBP4 to alternative cellular compartments using targeting sequences

    • Assess which localization patterns are essential for virulence

    • Determine if protein function is compartment-dependent

  • Direct target identification:

    • Implement proximity labeling methods (BioID, APEX) to identify direct interaction partners

    • Perform crosslinking studies to capture transient interactions

    • Use ribosome profiling to identify translation impacts

Such methodologies have been successfully employed with other H. capsulatum virulence factors, including heat shock proteins, where specific interactions with host receptors were distinguished from broader physiological effects .

How can CBP4 research inform antifungal drug development strategies?

CBP4 research provides several promising avenues for antifungal drug development:

  • Target validation rationale:

    • CBP4's essential role in fungal survival under calcium-limited conditions makes it an attractive drug target

    • Its dual function in mitochondrial assembly and calcium homeostasis suggests inhibitors would have multifaceted effects on fungal viability

    • The requirement of CBP4 for virulence in animal models indicates therapeutic relevance

  • Drug development approaches:

    • Structure-based design of small molecule inhibitors targeting calcium-binding sites

    • Screening for compounds that disrupt CBP4-cytochrome b mRNA interactions

    • Development of peptidomimetics that compete for critical protein-protein interactions

    • Identification of natural products that specifically inhibit CBP4 function

  • Screening methodologies:

    • High-throughput assays measuring calcium binding under physiological conditions

    • Reporter systems monitoring cytochrome b mRNA processing efficiency

    • Growth inhibition assays under calcium-limited conditions

    • Mitochondrial function assays in the presence of candidate inhibitors

  • Therapeutic advantages:

    • CBP4 lacks close human homologs, potentially reducing off-target effects

    • Targeting fungal-specific mitochondrial processes offers selectivity

    • Inhibiting adaptation to calcium-limited environments specifically targets pathogenic states

Researchers should consider that effective CBP4 inhibitors might show synergy with existing antifungals, particularly those affecting cell membrane integrity or cellular stress responses.

What considerations are important when evaluating CBP4 as a vaccine candidate?

When evaluating CBP4 as a potential vaccine candidate, researchers should address:

  • Immunogenicity assessment:

    • Characterize natural immune responses to CBP4 during human histoplasmosis

    • Determine T-cell epitope mapping for major histocompatibility complex presentation

    • Evaluate antibody responses in terms of titer, affinity, and functional activity

    • Compare immunogenicity across different patient populations and disease stages

  • Protective efficacy considerations:

    • Assess various immunization routes and adjuvant combinations

    • Determine correlates of protection in animal models

    • Evaluate cross-protection against different H. capsulatum strains and variants

    • Compare with other vaccine candidates, such as Hsp60, which has shown protection in murine models

  • Formulation strategies:

    • Test recombinant full-length vs. epitope-based approaches

    • Evaluate DNA, mRNA, and protein-based delivery platforms

    • Consider multivalent formulations combining CBP4 with other virulence factors

    • Assess thermostability and long-term storage requirements

  • Safety profile:

    • Evaluate potential cross-reactivity with human proteins

    • Assess risk of immunopathology through detailed histopathological studies

    • Monitor for disease enhancement effects in partially protected animals

    • Determine safety in immunocompromised models, the primary at-risk population

Studies with other H. capsulatum proteins, such as Hsp60, have demonstrated that vaccination can induce protection in lethal murine infection models, with protection mediated by CD4+ cells . Similar approaches could be applied to CBP4 vaccine development while accounting for its unique functional properties.

How can researchers overcome solubility and stability challenges with recombinant CBP4?

Researchers facing solubility and stability challenges with recombinant CBP4 can implement several strategies:

  • Expression system optimization:

    • Test multiple expression hosts (E. coli, P. pastoris, mammalian cells)

    • Evaluate codon optimization for the chosen expression system

    • Explore fusion tags that enhance solubility (MBP, SUMO, thioredoxin)

    • Test inducible promoters with varying induction conditions

  • Buffer formulation improvements:

    • Incorporate 5-50% glycerol to enhance stability during storage

    • Test different pH ranges to identify optimal solubility conditions

    • Include calcium at physiologically relevant concentrations

    • Evaluate the addition of mild detergents or amino acid additives (arginine, glutamic acid)

  • Structural modifications:

    • Generate truncated constructs removing hydrophobic regions

    • Remove putative aggregation-prone sequences

    • Design rational mutations based on homology modeling

    • Consider domain-specific expression if full-length protein remains problematic

  • Purification strategy optimization:

    • Implement on-column refolding techniques

    • Use size exclusion chromatography to remove aggregates

    • Test affinity tags at both N- and C-termini

    • Explore mild solubilization conditions for inclusion bodies if necessary

  • Storage and handling practices:

    • Aliquot protein to avoid repeated freeze-thaw cycles

    • Consider lyophilization with appropriate excipients

    • Test flash-freezing in liquid nitrogen versus slow freezing

    • Evaluate protein stabilizers like trehalose or sucrose

These approaches have proven successful with other difficult-to-express fungal proteins and should be systematically tested for CBP4.

What experimental controls are essential when studying CBP4 function in different models?

Essential experimental controls for CBP4 functional studies include:

  • Genetic manipulation controls:

    • Empty vector controls for expression studies

    • Complemented knockout strains to confirm phenotype specificity

    • Random integration controls to account for positional effects

    • Isogenic background strains to minimize confounding genetic variables

  • Protein-specific controls:

    • Heat-denatured CBP4 to distinguish structure-dependent functions

    • Site-directed mutants affecting specific functional domains

    • Dose-response studies to establish concentration-dependent effects

    • Heterologous calcium-binding proteins to differentiate CBP4-specific effects

  • Environmental condition controls:

    • Calcium concentration matrices to determine threshold effects

    • Growth phase standardization across experiments

    • Temperature controls accounting for dimorphic transitions

    • pH standardization in all functional assays

  • Host-pathogen interaction controls:

    • Uninfected host cells with recombinant protein addition

    • Comparison with known virulence factor knockouts (e.g., Hsp60 mutants)

    • Host cell activation status standardization

    • Time-matched sampling to account for temporal dynamics

  • Technical validation controls:

    • Multiple biological and technical replicates

    • Alternative methodological approaches confirming key findings

    • Inter-laboratory validation for critical discoveries

    • Blinding procedures for subjective assessments

The implementation of these controls ensures that observed phenotypes can be confidently attributed to CBP4 function rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.