Recombinant Ajellomyces capsulata Golgi apparatus membrane protein TVP18 (TVP18)

Shipped with Ice Packs
In Stock

Description

Taxonomic Clarification

Ajellomyces capsulatus is the teleomorph (sexual form) of Histoplasma capsulatum, a pathogenic fungus causing histoplasmosis . While H. capsulatum has been extensively studied, no peer-reviewed studies or genomic annotations directly reference a "TVP18" protein in A. capsulatus.

Golgi Apparatus Proteins in Related Fungi

  • TVP23B (Trans-Golgi protein) is distinct from the hypothetical "TVP18" and is associated with intestinal mucus homeostasis in mice .

  • No homologous protein named "TVP18" is listed in H. capsulatum or A. capsulatus proteomic databases .

Proteomic and Genomic Analysis of H. capsulatum

Key findings from H. capsulatum studies include:

Table 1: Golgi-Related Proteins in H. capsulatum

Protein IDGene ProductFunctionLocalization
EEH10718.1Hypothetical proteinOligopeptide transportMembrane-bound
EEH09124.1Beta-1,3-glucanosyltransferaseCell wall synthesisMembrane-bound
EEH04925.1Hypothetical proteinSecreted antigenSecreted
EEH11056.1Hypothetical proteinMembrane transportMembrane-bound

These proteins are critical for virulence and host interaction but lack direct association with a "TVP18" designation .

Recombinant Protein Studies in H. capsulatum

Research on recombinant proteins focuses on vaccine candidates, such as:

  • Heat shock protein 60 (Hsp60): Induces protective CD8+ T-cell responses .

  • Sec31: Reduces fungal burden in murine models .

  • YPS3: Cell wall antigen linked to virulence .

No studies describe recombinant expression of a A. capsulatus TVP18 homolog.

Potential Explanations for the Absence of TVP18 Data

  • Nomenclature discrepancy: "TVP18" may refer to an uncharacterized protein or a naming variant not yet cataloged.

  • Research gap: This protein may be hypothetical or under investigation in unpublished studies.

  • Taxonomic misalignment: A. capsulatus is often studied as part of H. capsulatum research, and no distinct Golgi protein "TVP18" has been reported.

Recommendations for Further Research

To address this gap:

  1. Query specialized fungal genomics databases (e.g., FungiDB, UniProt) using A. capsulatus strain-specific identifiers.

  2. Investigate orthologs of yeast TVP23 or mammalian TVP23B in H. capsulatum proteomes.

  3. Screen A. capsulatus transcriptomes for hypothetical proteins with Golgi localization signals.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All of our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
TVP18; HCAG_00132; Golgi apparatus membrane protein TVP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
TVP18
Target Protein Sequence
MTIAEEFKSRNFSIYGQWTGVLCILLCFALGIANIFSKVIAFSIVCLASSFVIIFVEVPL LLRICPTSSTFDSFIRRFTTNYMRALMYVILSVVQWLSLIVGPSSLLAAAVVLSVSAIFY ALAGITKQEFMGSKTLGGQGVAQMIV
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP18 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the relationship between Ajellomyces capsulata and Histoplasma capsulatum?

Ajellomyces capsulata represents the teleomorphic (sexual) stage of Histoplasma capsulatum, which is the anamorphic (asexual) stage of this dimorphic fungal pathogen. Histoplasma capsulatum is naturally found in soil, and inhalation of its conidia can result in pulmonary histoplasmosis and, in severe cases, disseminated disease . The sexual reproduction process in this heterothallic species is regulated by a specialized genomic region known as the mating-type (MAT1) locus, with isolates containing one of two different MAT1 locus idiomorphs (MAT1-1 or MAT1-2) . Understanding proteins like TVP18 in both stages of the fungus provides insights into its cellular biology and potentially its pathogenicity.

How is TVP18 structured and what are its key domains?

TVP18 is a small membrane protein with multiple transmembrane domains. Analysis of its amino acid sequence reveals that it is predominantly hydrophobic with several transmembrane segments that anchor it to the Golgi membrane . The protein contains characteristic sequences that determine its specific localization to the late Golgi compartment.

Table 1: Key Features of TVP18 Protein

FeatureDescriptionReference
Molecular Mass18 kDa
Number of amino acids146 aa (A. capsulata)
Predicted transmembrane domains2-3
LocalizationLate Golgi compartment (Tlg2-positive vesicles)
Genomic contextAdjacent to MOT3 locus in yeast genome

What experimental methods are used to study TVP18 localization in fungal cells?

Studying TVP18 localization in fungal cells requires a combination of biochemical and microscopic techniques:

  • Immunofluorescence microscopy: Using antibodies specific to TVP18, researchers can visualize its distribution within fungal cells. Double immunofluorescence staining with established Golgi markers (such as Sed5 for early Golgi or Tlg2 for late Golgi) can precisely determine the subcompartmental localization .

  • Cell fractionation and immunoblotting: Differential centrifugation and density gradient centrifugation can separate Golgi subcompartments based on size and density. Subsequent immunoblotting with anti-TVP18 antibodies confirms which fraction contains the protein .

  • Immunoisolation of vesicles: Antibodies against specific SNARE proteins (Sed5 or Tlg2) can be used to isolate vesicles from different Golgi subcompartments. The presence of TVP18 can then be detected in these isolated vesicles by immunoblotting or mass spectrometry .

  • Epitope tagging and microscopy: Creating fusion proteins with fluorescent tags (GFP, RFP) or small epitope tags (Myc, HA) allows for live-cell imaging or immunodetection of TVP18 to track its dynamics and localization .

How does TVP18 differ between Saccharomyces cerevisiae and Ajellomyces capsulata?

While both S. cerevisiae and A. capsulata possess TVP18 orthologs, there are notable differences between them:

Table 2: Comparison of TVP18 in S. cerevisiae and A. capsulata

FeatureS. cerevisiae TVP18A. capsulata TVP18
FunctionUnknown, potentially involved in sterol transportPresumed Golgi structure/function
Genomic contextAdjacent to MOT3 locus, affecting sterol uptakeNot fully characterized
InteractionsNot extensively characterizedNot fully characterized
ConservationReference sequenceShows evolutionary conservation

The functional significance of these differences remains an active area of research. Comparative studies between these organisms can provide insights into the evolution of Golgi apparatus organization and function in different fungal species .

What is known about the role of TVP18 in the Golgi trafficking pathway?

Current evidence suggests that TVP18 plays a role in the organization and/or function of the late Golgi compartment (Tlg2-positive vesicles). While its precise function remains unclear, several hypotheses exist:

  • Structural role: TVP18 may contribute to the structural integrity or formation of specific Golgi subcompartments .

  • Protein retention: Similar to other Golgi proteins like Svp26, TVP18 might function in retaining specific membrane proteins in the late Golgi compartment .

  • Vesicular transport: TVP18 could facilitate vesicle formation, targeting, or fusion in the late secretory or endocytic pathways .

  • Indirect effect on sterol metabolism: In S. cerevisiae, the genomic location of TVP18 adjacent to the MOT3 locus suggests it may indirectly affect sterol uptake and metabolism by influencing MOT3 expression .

How can researchers distinguish between direct TVP18 functions and indirect effects through MOT3 regulation?

The genomic proximity of TVP18 to the MOT3 locus complicates functional studies, as observed phenotypes may result from altered MOT3 expression rather than direct TVP18 effects . To distinguish between these possibilities, researchers should implement several complementary approaches:

  • Gene replacement strategies: Replace the endogenous TVP18 with a functional tagged version at a different genomic location, separating it from MOT3. Compare phenotypes with the wild-type arrangement to identify location-dependent effects .

  • Simultaneous expression analysis: Use reverse transcription-QPCR to quantify both TVP18 and MOT3 transcripts in various experimental conditions, identifying potential regulatory relationships .

  • TVP18 overexpression with MOT3 knockout: Express TVP18 in a MOT3 deletion background to identify TVP18 functions independent of MOT3 .

  • Targeted mutagenesis: Create point mutations in TVP18 that maintain protein expression but potentially alter function, then analyze effects on MOT3 expression and cellular phenotypes .

  • Chromatin immunoprecipitation: Determine if TVP18 mutations affect chromatin structure or transcription factor binding at the MOT3 locus.

As demonstrated in sterol uptake studies, insertion of a transposon into the TVP18 locus increased MOT3 mRNA levels, which subsequently decreased expression of ABC transporters AUS1 and PDR11, ultimately reducing sterol incorporation by approximately 60-70% . This highlights the importance of carefully designed controls to distinguish direct from indirect effects.

What proteomics approaches can best characterize TVP18 interactors in pathogenic fungi?

  • Immunoprecipitation coupled with mass spectrometry (IP-MS): Using anti-TVP18 antibodies or epitope-tagged TVP18 to pull down the protein complex, followed by mass spectrometry to identify interacting proteins .

  • Proximity labeling: Expressing TVP18 fused to enzymes like BioID or APEX2 that biotinylate nearby proteins, allowing for subsequent streptavidin-based purification and identification of proximal proteins.

  • Cross-linking mass spectrometry (XL-MS): Using chemical cross-linkers to stabilize transient interactions before purification and mass spectrometry analysis.

  • Membrane yeast two-hybrid assays: Adapted for membrane proteins like TVP18 to detect protein-protein interactions in a cellular context.

  • Quantitative vesicle proteomics: Compare protein composition of vesicles from wild-type and TVP18-knockout strains to identify dependent localization of other proteins .

When implementing these approaches in pathogenic fungi like A. capsulata, researchers must consider:

  • The dimorphic nature of the organism (yeast vs. mycelial forms)

  • Potential differences in protein interactions between morphological states

  • Safety considerations when working with pathogenic organisms

  • Appropriate controls to account for non-specific interactions

What is the evolutionary significance of TVP18 conservation across fungal species?

The conservation of TVP18 across diverse fungal species, including both pathogenic and non-pathogenic fungi, suggests important fundamental roles in cellular function. Several research questions arise from this conservation:

  • Functional conservation vs. divergence: Does TVP18 serve the same function across species, or has it been adapted for species-specific roles?

  • Correlation with pathogenicity: Is there any correlation between TVP18 sequence variation and fungal pathogenicity?

  • Structural conservation: Which domains of TVP18 are most highly conserved, potentially indicating functional importance?

  • Co-evolution with interacting partners: Have TVP18 and its interacting proteins co-evolved across fungal lineages?

Evolutionary analyses comparing TVP18 sequences across fungi can provide insights into its fundamental importance and potential specialization. Particularly interesting would be comparative analyses between the non-pathogenic S. cerevisiae, the dimorphic pathogen A. capsulata, and other fungal pathogens to identify conserved and divergent features potentially related to pathogenicity.

What are the optimal conditions for expressing and purifying recombinant TVP18 for structural studies?

Membrane proteins like TVP18 present unique challenges for recombinant expression and purification. Based on current research practices, the following optimized approach is recommended:

  • Expression system selection:

    • E. coli: Use C41(DE3) or C43(DE3) strains specially designed for membrane protein expression

    • Yeast: Pichia pastoris or S. cerevisiae for eukaryotic expression with native folding machinery

    • Baculovirus-insect cell system: For higher yields of properly folded eukaryotic membrane proteins

  • Construct design:

    • Include an N- or C-terminal affinity tag (His6, FLAG, or Strep-tag II)

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Optimize codon usage for the expression host

    • Include a cleavable tag for structural studies

  • Membrane extraction and solubilization:

    • Test multiple detergents (DDM, LMNG, GDN) to identify optimal solubilization conditions

    • Consider nanodiscs or SMALPs for maintaining a lipid environment

  • Purification strategy:

    • Initial IMAC purification via His-tag

    • Size exclusion chromatography to ensure monodispersity

    • Optional ion exchange chromatography for further purification

  • Quality control:

    • SDS-PAGE and Western blotting to confirm identity

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

Table 3: Troubleshooting Common Issues in TVP18 Purification

IssuePotential CauseSolution
Low expressionToxicity to hostReduce induction temperature, use tightly controlled promoter
Protein aggregationImproper foldingScreen different detergents, add stabilizing agents
Loss during purificationWeak binding to resinAdjust imidazole concentration, pH, or salt conditions
DegradationProtease activityAdd protease inhibitors, reduce purification time
Poor stabilityDetergent mismatchTest detergent exchange during purification

How can TVP18 function be assessed in the context of Histoplasma pathogenesis?

Investigating TVP18's role in Histoplasma pathogenesis requires specialized approaches that bridge cellular and infection biology:

  • Gene knockout/knockdown strategies:

    • CRISPR-Cas9 gene editing to create TVP18-deficient strains

    • RNA interference to achieve partial knockdown

    • Regulatable promoter systems to control TVP18 expression

  • Cellular phenotype assessment:

    • Growth rate comparisons in different media and temperatures

    • Morphological transition between yeast and mycelial forms

    • Stress resistance (oxidative, pH, temperature)

    • Cell wall composition and integrity

  • Virulence factor secretion analysis:

    • Quantify secretion of known virulence factors in TVP18-deficient strains

    • Proteomic analysis of secretome changes

    • Trafficking of labeled virulence factors in live cells

  • Infection models:

    • Macrophage infection assays (survival, replication, phagosome manipulation)

    • Murine pulmonary infection model (fungal burden, inflammatory response)

    • Zebrafish larval infection for real-time visualization

  • Protein trafficking and localization:

    • Fluorescently tagged virulence factors to track trafficking

    • Co-localization with organelle markers

    • Live-cell imaging during host-pathogen interaction

By combining these approaches, researchers can determine whether TVP18 affects pathogenesis directly through altered protein trafficking, indirectly by influencing cell wall composition or stress responses, or potentially through other mechanisms not yet characterized.

What bioinformatics tools and databases are most valuable for TVP18 research?

Several bioinformatics resources are particularly useful for TVP18 research:

  • Protein structure prediction:

    • AlphaFold2 and RoseTTAFold for accurate structural modeling

    • TMHMM, TOPCONS for transmembrane domain prediction

    • PredictProtein for functional site prediction

  • Homology identification:

    • BLAST and PSI-BLAST for identifying TVP18 homologs

    • OrthoMCL for ortholog clustering across species

    • FungiDB for fungal-specific homology searches

  • Functional annotation:

    • InterPro for domain and motif identification

    • Gene Ontology for functional categorization

    • STRING for protein-protein interaction prediction

  • Evolutionary analysis:

    • MEGA for phylogenetic tree construction

    • PAML for detecting selection signatures

    • Ensembl Fungi for genomic context comparison

  • Expression data integration:

    • FungiDB and AspGD for transcriptomic data across conditions

    • Expression Atlas for cross-species expression pattern comparison

For researchers new to TVP18 analysis, a recommended workflow would begin with transmembrane topology prediction, followed by homology searches to identify conserved regions, structural modeling to predict protein architecture, and finally integration with transcriptomic and proteomic data to hypothesize functional contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.