Recombinant Ajellomyces capsulata High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification Methodology

The production of recombinant SHO1 protein involves expression in E. coli bacterial systems, which offers advantages in terms of scalability and yield for research applications . The protein is tagged with a histidine (His) sequence at the N-terminus, facilitating purification through affinity chromatography . This methodology ensures high purity levels, reported to be greater than 90% as determined by SDS-PAGE analysis .

The resulting purified protein is provided as a lyophilized powder, which enhances stability during storage and transportation . For reconstitution, the manufacturer recommends dissolving the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . The addition of glycerol at 5-50% (with a default recommendation of 50%) is suggested for long-term storage at -20°C/-80°C .

Functional Role in Cellular Signaling

SHO1 proteins function primarily as transmembrane osmosensors involved in high osmolarity signaling pathways . By analogy with homologous proteins in other fungi, the Ajellomyces capsulata SHO1 likely plays a critical role in detecting changes in environmental osmolarity and transmitting these signals to downstream effectors . This function is crucial for the adaptation of fungi to osmotic stress conditions encountered during host infection and environmental changes.

In Aspergillus fumigatus, a related fungal pathogen, the SHO1 homolog (shoA) functions as a transmembrane osmosensor within the High Osmolarity Glycerol (HOG) pathway . The HOG pathway represents a conserved signaling cascade in fungi that enables adaptation to hyperosmotic conditions through the regulation of glycerol production and other osmotic stress responses . By extension, the Ajellomyces capsulata SHO1 likely serves a similar function in environmental sensing and signal transduction.

Comparative Analysis with Homologs in Other Fungi

The SHO1 protein belongs to a conserved family of osmosensors present across various fungal species. The Saccharomyces cerevisiae SHO1 (High osmolarity signaling protein SHO1) consists of 367 amino acids, making it somewhat larger than the 292-amino acid Ajellomyces capsulata homolog . Both proteins feature N-terminal His tags when produced recombinantly and maintain similar functional domains despite sequence variations .

In Aspergillus fumigatus, the SHO1 homolog (shoA, Afu5g08420) functions within a complex signaling network that includes several additional components of the HOG pathway . These include histidine kinases (fhk6, tcsA), phosphotransfer proteins (phkA), response regulators (ssk1, srrB), and downstream effectors such as the PBS2 mitogen-activated protein kinase and the HOG1/SakA mitogen-activated protein kinase .

Table 2: Comparison of SHO1 Homologs Across Fungal Species

SpeciesProtein NameLength (aa)UniProt IDKey Functions
Ajellomyces capsulataSHO1292A6QTM4Osmosensing, high osmolarity signaling
Saccharomyces cerevisiaeSHO1367E7KMS3Osmosensing, high osmolarity signaling
Aspergillus fumigatusShoA (Afu5g08420)Not specified in search resultsNot specifiedTransmembrane osmosensor in HOG pathway

Research Applications and Potential Therapeutic Relevance

The recombinant SHO1 protein offers valuable applications in research focused on fungal stress response mechanisms, particularly those related to osmotic adaptation. As a component of signaling pathways that influence cell wall remodeling and stress tolerance, understanding SHO1 function may provide insights into fungal adaptation during host infection .

In Aspergillus fumigatus, disruption of calcium-responsive transcription factors and associated signaling pathways affects caspofungin resistance and stress tolerance . By extension, components of the HOG pathway, including SHO1 homologs, represent potential targets for antifungal development. Research using purified recombinant proteins like the Ajellomyces capsulata SHO1 enables detailed structural and functional studies to explore such therapeutic possibilities.

Additionally, the availability of recombinant SHO1 facilitates the development of antibodies and other detection tools that can be used to study the expression, localization, and modification of this protein under various physiological and pathological conditions. Such tools are valuable for investigating the role of SHO1 in Ajellomyces capsulata stress response and pathogenesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHO1; HCAG_00730; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
SHO1
Target Protein Sequence
MARMDFNNIVGDPFALIAWLLSFATCVISDIQGAFPNFAWWAVGYMLCAIIGISLVLASQ TSHVYGVAIVGYLAAGLTFTTLAVNSLIYDDQASKQAGAAGFILQSMVTIVWIFYFGSSS QTSSRPYLDSMGAGKEHPSYRNSKPLSTNYGARPETVVSGNQPPQMYTSAQLNGFETSSP VSGYPPTAANGAENGTQNRFVGPAIGSQSNLGGGSTLGADHPSTPNEVSQPTVYPYRAKA IYSYEANPDDANEISFSKHEILDVSDVSGRWWQAKKASGETGIAPSNYLILI
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of SHO1 protein in fungal systems?

SHO1 is a four-transmembrane (TM) domain protein that functions as an osmosensor in the High Osmolarity Glycerol (HOG) pathway, particularly well-characterized in the HKR1 sub-branch. The protein forms planar oligomers with a distinctive dimers-of-trimers architecture, created through dimerization at the TM1/TM4 interface and trimerization at the TM2/TM3 interface . This structural arrangement is critical for its function.

When exposed to high external osmolarity, SHO1 undergoes significant structural changes in its transmembrane domains. These conformational shifts enable SHO1 to bind to cytoplasmic adaptor proteins, particularly Ste50, which subsequently leads to Hog1 activation . Additionally, SHO1 interacts with other transmembrane proteins such as Opy2 and Hkr1 at specific interfaces, forming a multi-component signaling complex essential for the osmotic stress response pathway's function .

What are the optimal conditions for reconstitution of recombinant SHO1 protein?

For optimal reconstitution of recombinant His-tagged SHO1 protein:

  • Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material settles at the bottom.

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) to promote stability during storage.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

  • Store working aliquots at 4°C for up to one week for immediate experiments.

  • For long-term storage, maintain aliquots at -20°C/-80°C .

The protein will be in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability . When preparing experimental samples, consider that SHO1 is a membrane protein with multiple transmembrane domains, which may require appropriate detergents or lipid environments for maintaining native conformation and function.

How can researchers effectively study SHO1 protein interactions with other signaling components?

Co-immunoprecipitation assays have proven effective for studying SHO1 protein interactions, particularly with adaptor proteins like Ste50. When designing such experiments:

  • Consider using osmotic stress conditions to induce physiologically relevant interactions. Previous research has demonstrated that while wild-type Ste50 doesn't bind to SHO1 under normal conditions, this interaction is induced by osmotic stress .

  • Include both positive and negative controls:

    • Hyperactive mutants (e.g., Ste50-D146F) that constitutively bind to SHO1 can serve as positive controls .

    • Non-interacting proteins can serve as negative controls to verify specificity.

  • Design constructs with appropriate epitope tags for detection and precipitation.

  • Use a native membrane environment or suitable detergent conditions to maintain SHO1's transmembrane structure.

Experimental ApproachApplicationKey Considerations
Co-immunoprecipitationProtein-protein interactionsRequires appropriate antibodies and maintaining membrane protein integrity
FRET/BiFCIn vivo interaction studiesRequires fluorescent protein fusions that don't disrupt function
Yeast two-hybridDomain-specific interactionsMay not work well for full transmembrane proteins
Structural analysisDetailed interface mappingChallenging with membrane proteins; may require specialized approaches

When analyzing SHO1 interactions under osmotic stress, it's crucial to carefully control osmolarity conditions and timing, as interactions may be transient or dependent on specific osmotic stress levels.

How does sexual reproduction in Ajellomyces capsulatus (teleomorph of Histoplasma capsulatum) relate to osmotic sensing pathways?

Ajellomyces capsulatus represents the sexual or teleomorphic stage of the pathogenic fungus Histoplasma capsulatum. Sexual reproduction in this organism is governed by a specialized genomic region known as the mating-type (MAT1) locus .

Sexual reproduction in A. capsulatus results from interactions between opposite mating types, designated as (+) and (-). These mating types correspond to different MAT1 locus idiomorphs:

  • MAT1-1 corresponds to the (+) mating type

  • MAT1-2 corresponds to the (-) mating type

These idiomorphs contain unrelated sequences encoding different transcription factors that regulate mating processes . While there's no direct evidence in the provided sources linking SHO1 to sexual reproduction in A. capsulatus, osmotic sensing pathways often interact with other cellular signaling systems. In many fungi, environmental sensing (including osmotic stress) can influence mating behaviors and morphological transitions.

Interestingly, clinical and environmental isolates show different distributions of mating types:

  • Environmental samples exhibit a balanced 1:1 ratio of mating types

  • Clinical specimens show a skewed 7:1 ratio favoring the (-) mating type

This suggests potential differences in virulence or adaptation between mating types, which might involve environmental sensing mechanisms.

What methodologies are recommended for studying mating type compatibility in pathogenic fungi?

PCR-based approaches have proven effective for analyzing MAT locus idiomorphs in pathogenic fungi. Based on research with H. capsulatum isolates from different geographical regions:

  • Design PCR primers specific to the MAT1-1 and MAT1-2 idiomorphic regions.

  • Use reference strains with known mating types as controls:

    • G-217B (+) strain for MAT1-1

    • G-186AR (-) strain for MAT1-2

  • Sequence PCR products to confirm identity and allow for genetic diversity analysis.

  • When studying clinical isolates, compare mating type distributions to environmental isolates from the same geographical region.

For in vitro mating studies, be aware that fertility in laboratory cultures of H. capsulatum can be lost rapidly during continuous culture, suggesting that selective pressures in the natural environment may be important for maintaining mating competence . This loss of fertility may complicate experimental designs and should be considered when planning long-term studies with laboratory strains.

How might SHO1 homologs in pathogenic fungi contribute to virulence mechanisms?

While direct evidence linking SHO1 to virulence in pathogenic fungi is limited in the provided sources, several theoretical connections can be proposed based on the known functions of osmosensing pathways:

  • Dimorphic fungi like H. capsulatum undergo morphological transitions between yeast and filamentous forms that are critical for pathogenicity. Since these transitions are often triggered by environmental factors (temperature, pH, nutrients), osmosensing pathways might participate in coordinating these responses .

  • The observation that (+) and (-) mating types of H. capsulatum might differ in their ability to produce infectious propagules suggests potential links between mating pathways and virulence factors. If osmosensing pathways like those involving SHO1 cross-talk with mating pathways, they could indirectly influence virulence.

  • Adaptation to host environments often involves responding to osmotic challenges. Pathogens must survive transitions between different host microenvironments with varying osmolarities, potentially making osmosensors like SHO1 important for in vivo survival and dissemination.

For researchers investigating these connections, recommended approaches include:

  • Generating knockout strains lacking SHO1 homologs in pathogenic fungi

  • Testing virulence in appropriate animal models

  • Examining gene expression changes in osmotic stress conditions that mimic host environments

  • Investigating potential cross-talk between osmosensing and known virulence pathways

What structural features of SHO1 are critical for its function as an osmosensor?

SHO1's function as an osmosensor depends on specific structural features, particularly within its transmembrane domains:

  • The oligomeric architecture of SHO1 is crucial - it forms planar oligomers with a dimers-of-trimers arrangement through:

    • Dimerization at the TM1/TM4 interface

    • Trimerization at the TM2/TM3 interface

  • These specific interfaces not only mediate SHO1 self-association but also enable interactions with other transmembrane proteins:

    • The TM1/TM4 interface interacts with Opy2

    • The TM2/TM3 interface interacts with Hkr1

  • High external osmolarity induces conformational changes in these transmembrane domains, which subsequently:

    • Promotes binding to cytoplasmic adaptor proteins (particularly Ste50)

    • Facilitates formation of a multi-component signaling complex

    • Leads to Hog1 activation

Researchers investigating these structural features might consider:

  • Site-directed mutagenesis of key interface residues

  • Crosslinking studies to capture dynamic interactions

  • Structural analyses using techniques suitable for membrane proteins

  • Functional assays measuring osmotic stress response pathway activation

What are the key considerations when working with recombinant SHO1 protein in experimental systems?

When working with recombinant SHO1 protein:

  • Storage and stability:

    • Avoid repeated freeze-thaw cycles as these can denature the protein

    • Store working aliquots at 4°C for up to one week

    • Maintain long-term storage at -20°C/-80°C with appropriate cryoprotectants (glycerol at 50% final concentration is recommended)

  • Reconstitution:

    • Use deionized sterile water for initial reconstitution

    • Consider the membrane protein nature of SHO1 when designing buffers

    • Final concentration should be between 0.1-1.0 mg/mL for optimal stability

  • Experimental design:

    • Remember that SHO1 has multiple transmembrane domains that may require appropriate membrane mimetics or detergents

    • Consider the oligomeric nature of the protein when interpreting results

    • Include osmotic stress conditions when studying functional aspects

  • Quality control:

    • Verify protein integrity by SDS-PAGE (expected purity >90%)

    • Consider functional assays to confirm activity after reconstitution

How can researchers design experiments to distinguish between direct and indirect effects of osmotic stress on SHO1-mediated signaling?

Designing experiments to distinguish direct from indirect effects on SHO1 signaling requires careful controls and multiple approaches:

  • Use structure-guided mutants:

    • Create SHO1 mutants with modifications in the transmembrane domains implicated in osmosensing

    • Compare responses of wild-type and mutant proteins to osmotic stress

    • If mutants fail to respond to osmotic stress but maintain other functions, this suggests direct sensing

  • Employ in vitro reconstitution systems:

    • Purify SHO1 and key interacting partners (like Ste50)

    • Establish minimal systems in defined membrane environments

    • Test whether osmotic stress directly induces SHO1-Ste50 interaction in the absence of other cellular components

  • Implement time-course analyses:

    • Monitor the timing of SHO1 conformational changes relative to other cellular responses

    • Direct effects would typically occur rapidly after osmotic stress application

    • Use rapid kinetic methods to capture early events

  • Utilize chemical genetics approaches:

    • Develop SHO1 variants with engineered sensitivity to specific small molecules

    • Compare responses to these molecules versus osmotic stress

    • Similar response patterns would support direct sensing mechanisms

  • Compare across species:

    • Examine SHO1 homologs from different fungi with varying osmotic stress tolerance

    • Functional conservation across diverse species would support fundamental importance in direct sensing

Through these methodological approaches, researchers can build a comprehensive understanding of how SHO1 functions as an osmosensor and its broader implications for fungal adaptation and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.