Recombinant Ajellomyces capsulata NADH-cytochrome b5 reductase 1 (CBR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
CBR1; HCAG_03865; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
CBR1
Target Protein Sequence
MAMFSWTSSEAINGMYIPSALLIFGTAIVKKEWLPYAVALAAILSGGKVFSNRQRKVLNP TEFQNFELKEKTIVSHNVAIYRFALPRPTDILGLPIGQHISLAATIEGQTKEIMRSYTPI SSDQEAGYFDLLVKAYPQGNISKHLAGLRIGQTMKVRGPKGAMVYTPNMVKKIGMIAGGT GITPMLQIIKAIIRGRPRNGGNDTTQVDLIFANVNPDDILLKDELDQLAKEDDGFRVFYV LNNPPEGWEGGVGFVTPDMIRAKLPAAAPDTKVLICGPPPMVSAMKKATESLGFKKAGLV SKLEDQVFCF
Uniprot No.

Target Background

Function
Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Ajellomyces capsulata NADH-cytochrome b5 reductase 1 (CBR1) and what is its relationship to Histoplasma capsulatum?

Ajellomyces capsulata NADH-cytochrome b5 reductase 1 (CBR1) is a flavoprotein enzyme involved in electron transfer processes within the fungal cell. It catalyzes the reduction of cytochrome b5 using NADH as an electron donor. It's important to note that Ajellomyces capsulata is the teleomorphic (sexual) form of Histoplasma capsulatum, which is the anamorphic (asexual) form of the same organism . Therefore, research findings on Histoplasma capsulatum CBR1 directly apply to understanding Ajellomyces capsulata CBR1, as they represent the same genetic material in different life cycle stages.

The study of transcriptional responses to reactive nitrogen species in Histoplasma capsulatum has identified CBR1 as one of the key genes induced during nitrosative stress, suggesting its role in the pathogen's defense against host immune responses .

How is CBR1 expression regulated during nitrosative stress in Ajellomyces capsulata?

CBR1 expression shows significant upregulation during exposure to reactive nitrogen species (RNS). Transcriptional profiling using genomic microarrays has demonstrated that CBR1 is part of a stress response network activated when the fungus encounters nitric oxide (.NO) or other nitrogen-derived antimicrobial compounds produced by host macrophages .

Based on the available data, CBR1 induction appears to be part of a coordinated response that includes multiple cellular pathways involved in countering RNS-induced damage. The tiling microarray analysis confirms that CBR1 is a genuine transcriptional unit with defined genomic boundaries that is specifically induced in response to nitrosative stress conditions .

What are the recommended methods for recombinant expression of Ajellomyces capsulata CBR1?

For recombinant expression of Ajellomyces capsulata CBR1, the following methodology has proven effective:

  • Vector Selection: Based on protocols established for similar fungal proteins, Gateway cloning systems can be effectively utilized. The CBR1 coding sequence should be PCR amplified from cDNA and cloned into an appropriate entry vector (such as pENTR2B) .

  • Promoter Selection: For controlled expression in fungal systems, copper-responsive promoters like the copper responsive protein 1 (CRP1) promoter can be utilized, which allows for inducible expression upon addition of copper sulfate .

  • Expression System: For fungal expression, transformation into Histoplasma capsulatum ura5- strain using telomeric plasmids has shown success. For bacterial expression, E. coli BL21(DE3) with a pET-based expression system is recommended.

  • Induction Parameters: When using the CRP1 promoter system, induction with 10 μM copper sulfate for 1.5-2 hours yields optimal protein expression levels .

What is the basic protocol for assessing CBR1 enzymatic activity?

The standard protocol for assessing CBR1 enzymatic activity involves:

  • Reaction Components:

    • Purified recombinant CBR1

    • NADH (electron donor)

    • Cytochrome b5 (electron acceptor)

    • Buffer system (typically phosphate buffer, pH 7.0-7.4)

  • Spectrophotometric Measurement:

    • Monitor the oxidation of NADH at 340 nm

    • Alternatively, follow cytochrome b5 reduction at 424 nm

  • Reaction Conditions:

    • Temperature: 25-37°C

    • Time course: 0-5 minutes

    • NADH concentration: 50-200 μM

    • Cytochrome b5 concentration: 10-50 μM

  • Data Analysis:

    • Calculate initial reaction velocities

    • Determine kinetic parameters (Km, Vmax) using Lineweaver-Burk or Eadie-Hofstee plots

How does Ajellomyces capsulata CBR1 contribute to nitrosative stress resistance mechanisms?

Ajellomyces capsulata CBR1 appears to be part of a sophisticated defense mechanism against host-derived reactive nitrogen species. The enzyme likely participates in multiple protective pathways:

  • Electron Transport Chain Protection: CBR1 may help maintain electron flow through respiratory complexes when normal pathways are inhibited by nitric oxide, preserving ATP production during stress conditions.

  • Redox Balance Maintenance: By recycling reducing equivalents (NADH/NAD+), CBR1 helps maintain cellular redox homeostasis disrupted by reactive nitrogen species .

  • Integration with Other Stress Response Systems: Transcriptional analysis shows that CBR1 is co-regulated with other genes involved in iron acquisition, protein folding/degradation, and DNA repair, suggesting a coordinated response to nitrosative stress .

  • Potential Interaction with Nitric Oxide Reductases: CBR1 may function in conjunction with P450 nitric oxide reductase (NOR1), which was shown to increase resistance to RNS when ectopically expressed in H. capsulatum .

The experimental evidence supporting these roles comes from transcriptional profiling data showing CBR1 upregulation coincident with other known stress response factors during exposure to nitric oxide donors such as DPTA NONOate and GSNO .

What are the methodological considerations for studying the role of CBR1 in fungal pathogenesis models?

When investigating CBR1's role in fungal pathogenesis, researchers should consider the following methodological approaches:

  • Gene Expression Systems:

    • Use copper-inducible promoters like CRP1 for controlled expression

    • Employ Gateway-compatible vectors for efficient cloning and expression

    • Consider telomeric vectors for stable integration in H. capsulatum

  • Experimental Stress Conditions:

    RNS SourceConcentration RangeTime PointsMeasurable Effects
    DPTA NONOate0.1-5 mM0h, 2h, 5h, 25hGrowth inhibition at ≥0.5 mM within 2h
    GSNO0.2-5 mM0h, 2h, 25h50% viability reduction at 5 mM after 25h

    These parameters are based on experimental conditions that effectively induced CBR1 expression in H. capsulatum studies .

  • Functional Analysis Approaches:

    • Ectopic expression using copper-inducible systems

    • Growth and viability assays under nitrosative stress conditions

    • Gene knockout/knockdown studies with appropriate controls

    • Transcriptional profiling using tiling microarrays or RNA-seq

    • Protein localization studies using fluorescent tags

  • In vivo Models:

    • Macrophage infection assays with activation by IFN-γ to induce nitric oxide production

    • Mouse models of histoplasmosis with varying immune status

How can researchers effectively differentiate between the functions of CBR1 and other related enzymes in the same fungal redox pathways?

Differentiating the specific functions of CBR1 from other redox enzymes requires a multi-faceted approach:

  • Targeted Gene Manipulation:

    • Generate single and multiple gene knockouts to identify unique and redundant functions

    • Create conditional expression systems using promoters like CRP1 for controlled induction

    • Use CRISPR-Cas9 for precise genome editing when studying pathway interactions

  • Biochemical Characterization:

    • Determine substrate specificity profiles for purified recombinant CBR1

    • Measure enzyme kinetics under varying conditions (pH, temperature, substrate concentrations)

    • Perform inhibitor studies to identify specific modulators of CBR1 activity

  • Protein-Protein Interaction Studies:

    • Employ yeast two-hybrid or co-immunoprecipitation to identify interaction partners

    • Use proximity labeling techniques (BioID, APEX) to map the CBR1 interaction network

    • Analyze the CBR1 interactome under normal versus stress conditions

  • Comparative Analysis of Related Enzymes:

    EnzymeOrganismHomology to CBR1 (E-value)Known Function
    CBR1A. nidulans1E-129NADH-cytochrome b5 reductase
    NOR1H. capsulatumNot specifiedP450 nitric oxide reductase
    FBP26F. graminearum1E-166Fructose-2,6-bisphosphate 2-phosphatase
    RIB7A. nidulans0E+00HTP reductase

    These comparisons can help elucidate the unique evolutionary and functional roles of CBR1 .

What experimental approaches are most effective for studying CBR1 interactions with host immune components?

To investigate how CBR1 interacts with or responds to host immune components, researchers should consider:

  • Macrophage Infection Models:

    • Establish co-culture systems with primary or cell line macrophages

    • Use macrophage activation with IFN-γ to induce nitric oxide production

    • Compare wild-type H. capsulatum with CBR1 overexpression or knockout strains

    • Assess fungal survival, macrophage activation markers, and RNS production

  • Real-time Imaging of Fungal-Host Interactions:

    • Develop fluorescent reporter strains with CBR1 promoter-driven fluorescent proteins

    • Use live-cell microscopy to monitor CBR1 expression during macrophage interaction

    • Apply biosensors to measure nitrosative stress in real-time during infection

  • Transcriptomic and Proteomic Analysis:

    • Perform dual RNA-seq of both pathogen and host during infection

    • Use proteomics to identify post-translational modifications of CBR1 during infection

    • Compare transcriptional responses between wild-type and CBR1-modified strains

  • In vivo Models with Varying Immune Status:

    Mouse ModelImmune StatusExpected OutcomeMeasurement
    Wild-typeNormal immune functionControlled infectionFungal burden, cytokine profile
    iNOS-/-Deficient in nitric oxide productionEnhanced fungal growthComparison to wild-type
    IFN-γ-/-Reduced macrophage activationEnhanced fungal growthDifferential CBR1 expression
    ImmunosuppressedBroadly compromised immunityDisseminated infectionCBR1 expression patterns

How can structural biology approaches enhance our understanding of CBR1 function and facilitate drug discovery?

Structural biology provides crucial insights into CBR1 function and potential inhibitor design:

What are the common challenges in purifying recombinant Ajellomyces capsulata CBR1 and how can they be addressed?

Recombinant CBR1 purification presents several technical challenges:

  • Inclusion Body Formation:

    • Challenge: Overexpression often leads to inclusion body formation in bacterial systems

    • Solution: Optimize expression conditions (temperature reduction to 16-18°C, use of specialized E. coli strains like Rosetta or Arctic Express, co-expression with chaperones)

    • Alternative approach: Use fungal expression systems with the copper-inducible CRP1 promoter

  • Flavin Cofactor Incorporation:

    • Challenge: Incomplete FAD incorporation affects enzyme activity

    • Solution: Supplement expression media with riboflavin or FAD precursors

    • Analytical approach: Monitor A280/A450 ratio to assess flavin saturation

  • Protein Stability During Purification:

    • Challenge: CBR1 may show instability during purification steps

    • Solution: Include stabilizing agents (glycerol 10-20%, reducing agents like DTT or β-mercaptoethanol)

    • Storage recommendation: Store purified protein in small aliquots at -80°C with 50% glycerol

  • Activity Assessment:

    • Challenge: Variable activity measurements depending on assay conditions

    • Solution: Standardize assay conditions (buffer composition, pH, temperature, substrate concentrations)

    • Quality control: Include positive controls and reference standards in each assay batch

How can researchers effectively analyze CBR1 expression data obtained from different experimental contexts?

Proper analysis of CBR1 expression data requires careful consideration of experimental variables:

  • Normalization Strategies:

    • Use multiple reference genes that maintain stable expression under experimental conditions

    • Apply appropriate statistical normalization methods (quantile normalization for microarrays, TPM/FPKM for RNA-seq)

    • Consider spike-in controls for absolute quantification

  • Cross-Platform Data Integration:

    • When combining data from microarrays and RNA-seq, use validated conversion methods

    • Consider batch effects and experimental variations in meta-analyses

    • Employ standardized pipelines to minimize technical variability

  • Time-Course Analysis:

    Time PointAnalysis ApproachExpected PatternInterpretation
    Early (0-2h)Differential expressionRapid inductionImmediate stress response
    Middle (2-5h)Pathway enrichmentCoordinated inductionAdaptive mechanisms
    Late (>5h)Correlation networksReturn to baselineResolution or adaptation

    These analysis approaches align with observed patterns in H. capsulatum RNS response studies .

  • Integration with Other Data Types:

    • Correlate transcriptomic data with proteomic measurements

    • Connect gene expression changes to phenotypic outcomes (growth rate, viability)

    • Map expression data to metabolic pathways to understand system-level responses

How does the function of CBR1 in Ajellomyces capsulata compare with homologs in other pathogenic fungi?

Comparative analysis of CBR1 across fungal species reveals important evolutionary patterns:

  • Sequence Conservation Analysis:

    OrganismProteinE-value to A. capsulata CBR1Identity/SimilarityReference
    A. nidulansAN6366.21E-129High conservationEAA58750.1
    M. speciesNot specified2E-72Moderate conservationBAA85587.1
    C. albicansCbr1Not in dataPredicted similar functionInferred
    C. neoformansCNAG_03488Not in dataPredicted similar functionInferred
  • Functional Conservation:

    • Most fungal CBR1 homologs participate in electron transfer processes

    • The role in nitrosative stress response appears to be a conserved feature

    • Substrate specificity may vary between species, reflecting ecological adaptations

  • Expression Pattern Differences:

    • Different fungal pathogens show variable CBR1 induction kinetics under stress

    • Some species may use CBR1 in additional stress responses beyond nitrosative stress

    • Regulation mechanisms may differ while maintaining functional conservation

  • Evolutionary Implications:

    • CBR1 represents an ancient enzyme with conserved core function

    • Species-specific adaptations likely reflect host interaction pressures

    • Presence in both pathogenic and non-pathogenic fungi suggests fundamental metabolic roles

What novel approaches are being developed to target CBR1 and related enzymes for antifungal drug development?

Emerging strategies for targeting CBR1 in antifungal development include:

  • Structure-Based Drug Design:

    • Virtual screening against known CBR1 structural models

    • Fragment-based approaches to identify novel binding scaffolds

    • Structure-activity relationship studies to optimize selectivity

  • Pathway-Based Inhibition Strategies:

    • Target multiple components of the RNS response network simultaneously

    • Develop agents that synergize with host nitric oxide production

    • Create stress-sensitizing compounds that block adaptive responses

  • Novel Screening Platforms:

    • Develop high-throughput assays specific for fungal CBR1 activity

    • Use phenotypic screens under nitrosative stress conditions

    • Implement whole-cell assays in macrophage-fungal co-culture systems

  • Translational Approaches:

    ApproachTechnologyAdvantagesChallenges
    Rational designComputer-aided drug designStructure-guided optimizationRequires structural data
    RepurposingScreening existing drugsFaster development pathLimited chemical space
    Natural productsBioactivity-guided isolationNovel chemical scaffoldsComplex purification
    Combination therapyDrug synergy screeningReduced resistance developmentComplex interactions

How can systems biology approaches enhance our understanding of CBR1's role in the broader fungal stress response network?

Systems biology offers powerful frameworks for understanding CBR1's role:

  • Network Analysis of Stress Responses:

    • Construct gene regulatory networks from transcriptomic data

    • Identify hub genes and network motifs in RNS response

    • Compare network architecture across stress conditions

    • Map CBR1 within the broader stress response network context

  • Metabolic Modeling:

    • Develop constraint-based metabolic models incorporating CBR1

    • Simulate metabolic flux changes during nitrosative stress

    • Predict metabolic vulnerabilities during host-pathogen interaction

    • Integrate transcriptomic data to constrain flux predictions

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify causal relationships between molecular changes

    • Map post-translational modifications regulating CBR1 activity

    • Connect molecular changes to phenotypic outcomes

  • In silico Perturbation Analysis:

    • Simulate gene knockout/overexpression effects on system behavior

    • Predict compensatory mechanisms following CBR1 inhibition

    • Model evolutionary trajectories under selective pressure

    • Forecast resistance mechanisms to CBR1-targeting compounds

What are the most promising future research directions for CBR1 in fungal pathogenesis studies?

The study of Ajellomyces capsulata CBR1 presents several promising research avenues:

  • Host-Pathogen Interface Studies:

    • Investigate CBR1's role during different stages of infection

    • Determine how CBR1 expression changes in different host microenvironments

    • Explore the relationship between CBR1 activity and virulence in diverse clinical isolates

  • Resistance Mechanism Exploration:

    • Elucidate how CBR1 contributes to antifungal resistance

    • Investigate potential compensatory mechanisms when CBR1 is inhibited

    • Develop combination strategies targeting both CBR1 and complementary pathways

  • Translational Research Opportunities:

    • Develop CBR1-targeted diagnostics for fungal infection

    • Explore CBR1 as a biomarker for treatment response

    • Engineer attenuated strains with modified CBR1 expression for vaccine development

  • Methodological Advances:

    • Implement CRISPR-Cas9 systems for precise genome editing in A. capsulata

    • Develop better in vitro and ex vivo models of host-pathogen interaction

    • Create improved fungal gene expression systems with finer temporal control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.