Recombinant Ajellomyces capsulata NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MCR1; HCAG_03595; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
MCR1
Target Protein Sequence
MFARYTFRCSQPLAQSVRKYSSEAPAKSSRIPLIGGITLAAGAGYYYYWQTTSAKSEPKE RSTVFKGGDQGWIGLKLAHIDNVNHNVKKLRFEFEDPESVSGLHIASALLTKYKGLTDEK PTIRPYTPVSDEGMWASLGYLDLLVKRYPNGPMSNHLHNMAVGQRLDFKGPLPKYPWEPS KHDHICLIAGGTGITPMYQLVRKIFSNPEDKTKVTLVFANVTEEDILLRKEFEHLENTYP RRFRAFYTLDKPPKNWAQGTGFITKDLLKTVLPEPKTENIKIFVCGPPAMYKAISGQKVS PKDQGELSGILKELGYSKEQVYKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Ajellomyces capsulata NADH-cytochrome b5 reductase 2 (MCR1) and its relationship to Histoplasma capsulatum?

Ajellomyces capsulata NADH-cytochrome b5 reductase 2 (MCR1) is a flavoprotein encoded by the MCR1 gene (HCAG_03595) in the fungal pathogen Ajellomyces capsulata, which is the teleomorph (sexual stage) of Histoplasma capsulatum . This organism is the most common cause of fungal respiratory infections worldwide, with some strains causing potentially life-threatening complications . The protein consists of 324 amino acids with an EC classification of 1.6.2.2 and is also known as "Mitochondrial cytochrome b reductase" . The protein is part of the cytochrome b5 reductase family that catalyzes electron transfer reactions critical for various cellular processes in this medically significant pathogen.

What is the structure and function of NADH-cytochrome b5 reductase enzymes?

NADH-cytochrome b5 reductase enzymes consist of two primary domains: an NADH-binding domain and a flavin adenine dinucleotide (FAD) binding domain . The protein contains a catalytic core that facilitates electron transfer from NADH to FAD, which subsequently transfers electrons to cytochrome b5 . Crystal structure analysis at high resolution (0.78Å for oxidized form) reveals a hydrogen-bonding network from the N5 atom of FAD to His49 via Thr66, which is critical for the enzyme's function . The isoalloxazine ring of FAD in both reduced and oxidized forms maintains a flat conformation, with the nicotinamide ring of NAD+ stacking together with it in the reduced form . This structural arrangement prevents backflow in the catalytic cycle and accelerates electron transfer to one-electron acceptors like cytochrome b5.

How is recombinant MCR1 produced and purified for research purposes?

Recombinant MCR1 is typically produced using E. coli expression systems . The full-length protein (amino acids 1-324) or specific domains can be cloned into expression vectors such as pET28a, which typically introduces affinity tags (commonly His-tags) to facilitate purification . Expression is induced using IPTG (typically 0.5 mM) with incubation at lower temperatures (18°C) for extended periods (14+ hours) to enhance proper folding . After cell harvesting by centrifugation, the protein is purified using affinity chromatography, with the final product typically stored in Tris-based buffer with glycerol (up to 50%) at -20°C or -80°C to maintain stability . For optimal activity preservation, it's recommended to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for up to one week.

What catalytic mechanism does NADH-cytochrome b5 reductase employ?

NADH-cytochrome b5 reductase catalyzes the transfer of electrons from the two-electron carrier NADH to the one-electron carrier cytochrome b5 . The reaction proceeds through a multi-step mechanism: (1) NADH binds to the enzyme, (2) electrons are transferred to the FAD cofactor, reducing it fully, (3) a conformational shift occurs that increases the solvent-accessible surface area of FAD, (4) a new hydrogen-bonding interaction forms between the N5 atom of the isoalloxazine ring and Thr66, which facilitates proton release, and (5) the reduced FAD transfers electrons one at a time to cytochrome b5 molecules . Research has shown that re-oxidation likely follows a two-step mechanism, and the entire process prevents backflow while facilitating efficient electron transfer to one-electron acceptors .

How do isoforms of cytochrome b5 reductase differ in subcellular localization and function?

Cytochrome b5 reductase exists as different isoforms with distinct subcellular localizations regulated through several mechanisms . In mammals, a single gene generates multiple isoforms through alternative promoter usage and post-translational modifications . The ubiquitous form is myristylated and anchors to both the outer mitochondrial membrane and endoplasmic reticulum (ER), while an erythroid-specific transcript generates both soluble and non-myristylated membrane-binding forms . In contrast to the reductase, cytochrome b5 (the enzyme's electron acceptor) is encoded by two separate genes producing distinct isoforms: one targeting the outer mitochondrial membrane and another targeting the ER . An erythroid-specific splicing event likely generates a soluble cytochrome b5 form . These differences in localization suggest that different reductase-cytochrome b5 pairs may serve distinct metabolic functions depending on their subcellular compartmentalization.

What structural features contribute to substrate specificity in MCR1?

Structural analyses of cytochrome b5 reductase reveal key features that determine substrate specificity and catalytic efficiency . The relative configuration of the NADH and FAD binding domains is critical, as slight shifts between these domains in reduced versus oxidized states alter the solvent-accessible surface area of FAD and create new hydrogen-bonding interactions . Specific amino acid residues, such as lysine residues near the NADH binding site, play important roles in stabilizing NADH binding, as demonstrated by mutagenesis studies showing decreased catalytic efficiency (kcat) and increased Km values for NADH when these residues are substituted . The architecture of the active site creates a specific microenvironment that accommodates NADH binding while positioning it optimally for electron transfer to FAD . Additionally, the flat conformation of the isoalloxazine ring of FAD in both oxidized and reduced states appears to be important for proper stacking with the nicotinamide ring of NAD+ .

What experimental approaches can be used to study MCR1 interactions with electron transfer partners?

Several experimental approaches can be employed to study MCR1 interactions with electron transfer partners:

  • Co-immunoprecipitation (Co-IP): Using specific antibodies against MCR1 to pull down the protein along with its interacting partners, followed by mass spectrometry identification . This technique has successfully identified interaction partners of related proteins, revealing connections to stress response proteins, transcriptional regulators, and ribosomal proteins .

  • Enzymatic assays: Measuring electron transfer rates using spectrophotometric methods that track the reduction of cytochrome b5 or artificial electron acceptors . These assays can be performed under various conditions to determine kinetic parameters (kcat, Km) and the effects of potential inhibitors or enhancers.

  • Charge transfer assays: These specialized assays can assess the efficiency of NADH utilization and electron transfer .

  • X-ray crystallography: Determining the three-dimensional structure of MCR1 in complex with its partners at high resolution (ideally <2.0Å) to visualize interaction interfaces .

  • Site-directed mutagenesis: Systematically mutating residues hypothesized to be involved in partner interactions and measuring the effects on binding affinity and electron transfer efficiency .

How can researchers investigate the role of MCR1 in Histoplasma capsulatum pathogenesis?

To investigate MCR1's role in H. capsulatum pathogenesis, researchers can employ multiple complementary approaches:

  • Gene knockout or knockdown: Using CRISPR-Cas9 or RNAi to delete or reduce MCR1 expression, followed by phenotypic characterization in vitro and in infection models . This approach has been successfully used for related genes, with validation by PCR and Southern blot analysis.

  • Heterologous expression: Expressing MCR1 in model organisms to assess its effects on cellular processes potentially related to pathogenesis, such as stress response, oxidative metabolism, or interactions with host factors .

  • Comparative genomics: Analyzing MCR1 sequence conservation and variation across different H. capsulatum strains with varying virulence profiles, such as NAm I (primarily infecting immunocompromised hosts) versus NAm II (infecting otherwise healthy individuals) .

  • Functional interactome mapping: Using techniques like Co-IP combined with mass spectrometry to identify MCR1 interaction partners that might be involved in virulence-related functions .

  • In vivo expression analysis: Measuring MCR1 expression levels during different phases of infection to determine if it is upregulated during specific stages of pathogenesis .

What are the optimal conditions for assaying MCR1 enzymatic activity?

The optimal conditions for assaying MCR1 enzymatic activity include:

  • Buffer composition: Typically Tris-based buffers at pH 7.5-8.0, which provide a suitable environment for maintaining protein stability and activity .

  • Temperature: Assays are typically performed at 25-37°C, with the higher temperature more closely mimicking physiological conditions but potentially reducing stability over time .

  • Electron donors: NADH serves as the physiological electron donor, typically used at concentrations ranging from 10-500 μM in assays, with apparent Km values in the micromolar range .

  • Electron acceptors: Natural acceptor cytochrome b5 or artificial electron acceptors such as ferricyanide or dichlorophenolindophenol can be used, with the choice depending on the specific research question .

  • Spectrophotometric monitoring: Activity can be monitored by following the oxidation of NADH (decrease in absorbance at 340 nm) or the reduction of cytochrome b5 (increase in absorbance at 424 nm) .

  • Protein concentration: Typically in the nanomolar to low micromolar range to ensure linearity of the assay response .

  • Additives: The presence of glycerol (5-10%) can help stabilize the enzyme during assays .

How might post-translational modifications affect MCR1 function?

While specific post-translational modifications (PTMs) of Ajellomyces capsulata MCR1 are not directly described in the search results, general principles from related cytochrome b5 reductases suggest several potential modifications that could affect function:

  • Myristylation: In mammalian systems, myristylation of cytochrome b5 reductase is crucial for membrane targeting, with different isoforms showing distinct myristylation patterns that determine their subcellular localization . Similar lipid modifications could affect MCR1 localization and consequently its access to physiological partners.

  • Phosphorylation: Potential phosphorylation sites in the protein sequence could modulate activity, protein-protein interactions, or stability. Key residues like threonines and serines in functional domains would be candidates for regulatory phosphorylation.

  • Oxidative modifications: Given its role in electron transfer, MCR1 may be susceptible to oxidative modifications such as cysteine oxidation, which could serve as a regulatory mechanism or result in impaired function under oxidative stress conditions.

  • Proteolytic processing: Similar to how some cytochrome b5 reductases undergo proteolytic processing to generate soluble forms , MCR1 might be subject to regulated proteolysis that alters its localization or function.

What techniques can be used to study the structural dynamics of MCR1 during catalysis?

Several advanced techniques can be employed to study the structural dynamics of MCR1 during catalysis:

  • Time-resolved X-ray crystallography: This technique can capture various states of the protein during the catalytic cycle, as demonstrated by studies that have captured both oxidized (0.78Å resolution) and reduced (1.68Å resolution) states of related cytochrome b5 reductases . These studies have revealed subtle but significant domain shifts and new hydrogen-bonding interactions in the reduced state.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can identify regions of the protein that undergo conformational changes during catalysis by measuring the rate of hydrogen-deuterium exchange in various parts of the protein under different conditions.

  • Single-molecule FRET (Förster Resonance Energy Transfer): By labeling different domains with appropriate fluorophores, researchers can monitor domain movements during catalysis in real-time.

  • Cryo-electron microscopy (cryo-EM): This technique can be particularly useful for visualizing larger complexes of MCR1 with its interaction partners, potentially capturing transient states in the catalytic cycle.

  • Molecular dynamics simulations: Computational approaches can model the dynamic behavior of MCR1 during catalysis, providing insights into conformational changes and energy landscapes that may be difficult to capture experimentally.

  • Cryo-trapping methods: As mentioned in the research, these methods can capture reaction intermediates and have suggested that re-oxidation follows a two-step mechanism in related reductases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.