Recombinant Ajellomyces capsulata Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its use in production.
Synonyms
GET1; HCAG_08959; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
GET1
Target Protein Sequence
MPSLLITVLFLNVIIYVINTVGAATVDGLLWLLYIKLPTGTSQIAREQRHMKREVVQLKH EMSSTSSQDEFAKWAKLRRRHDKAMEAYEAKNNELTQSKSTFDMTIKIARWAATSGLMLF LQFWYSKTPIFTLPPGWIPWQVQWVLSFPRAPMGTVSIQIWGGACATVVALVGDAMRASL AYVSKPKIDRIKLGATMEGKEGKKRQ
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Ajellomyces capsulata Protein GET1 and what is its role in cellular processes?

Ajellomyces capsulata Protein GET1 is a key component of the guided entry of tail-anchored proteins (GET) pathway, which mediates the biogenesis of tail-anchored (TA) membrane proteins at the endoplasmic reticulum. The GET1 protein forms part of the GET insertase complex (along with GET2), which is responsible for inserting substrate proteins via a membrane-embedded hydrophilic groove. This mechanism is critical for proper cellular protein trafficking and membrane protein localization . The protein functions as part of a sophisticated molecular machine that ensures proper insertion of tail-anchored proteins, which are involved in numerous essential cellular processes.

How does GET1 protein relate to Histoplasma capsulatum?

Ajellomyces capsulata is the teleomorph (sexual form) of Histoplasma capsulatum, which is also known as the Darling's disease fungus. Histoplasma capsulatum is a dimorphic fungal pathogen and the most frequent cause of clinically significant fungal pneumonia in humans . While GET1 itself has not been directly implicated in virulence, understanding its function in this organism may provide insights into fundamental cellular processes that support the pathogen's survival and pathogenicity.

What are the primary research applications for recombinant Ajellomyces capsulata GET1 protein?

Recombinant Ajellomyces capsulata GET1 protein is primarily used in research focused on:

  • Structural biology studies of membrane protein insertion mechanisms

  • Functional characterization of the GET pathway components

  • Investigation of tail-anchored protein biogenesis

  • Comparative studies of GET pathway machinery across species

  • Structure-function relationship analyses of the GET insertase complex

The recombinant protein enables researchers to perform in vitro reconstitution experiments, binding assays, and structural studies that would otherwise be challenging with endogenous protein .

How does the GET1-GET2-GET3 complex form and function in tail-anchored protein insertion?

The GET insertase complex exhibits a sophisticated mechanism for tail-anchored protein insertion. GET3 functions as a cytosolic chaperone that captures the tail-anchored protein substrate and delivers it to the GET1/GET2 membrane protein complex. Upon interaction with the GET insertase, conformational changes occur in both GET3 and the GET1/GET2 complex.

The hydrophilic groove formed by GET1 transmembrane domains provides a transient binding site for the substrate's polar C-terminal extension as it traverses the endoplasmic reticulum membrane. The GET1/GET2 heterotetramer (in a 2:2 stoichiometry) is stabilized by GET3 and interfacial lipid binding, which is crucial for efficient TA protein insertion . The GET insertase exhibits conformational plasticity that promotes substrate insertion by remodeling the membrane environment.

ComponentFunction in GET Complex
GET1Forms hydrophilic groove for substrate passage; contains cytosolic domain for GET3 interaction
GET2Partners with GET1 to form insertase; N-terminus interacts with GET3
GET3Cytosolic chaperone; delivers TA proteins to GET1/GET2 complex
GET1/GET2 ComplexForms 2:2 heterotetramer; creates insertion pathway across membrane

What conformational changes occur in the GET insertase during substrate protein insertion?

Recent structural studies have revealed that the GET insertase exhibits significant conformational plasticity during the insertion process. The GET1/GET2 heterotetramer undergoes conformational changes in response to interactions with GET3, particularly through the gating interaction between helix α3' and GET3. These changes are believed to facilitate the opening of the hydrophilic groove to accept the tail-anchored substrate .

How do the structures of GET pathway components compare between different organisms?

The extent of structural conservation across different fungal species, including Ajellomyces capsulata and Chaetomium thermophilum, provides insights into the evolutionary significance of the GET pathway. While Saccharomyces cerevisiae has long been the model system for studying the GET pathway, newer structural data from diverse organisms is expanding our understanding of the mechanism's conservation and specialization .

What are the optimal storage and handling conditions for recombinant Ajellomyces capsulata GET1 protein?

For optimal stability and activity of recombinant Ajellomyces capsulata GET1 protein, the following conditions are recommended:

Storage conditions:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Storage buffer:

  • Tris/PBS-based buffer

  • pH 8.0

  • 6% Trehalose

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% of glycerol (recommended final concentration: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

These handling protocols are critical for maintaining protein integrity and functionality in experimental settings.

What expression systems are most effective for producing functional recombinant GET1 protein?

  • Heterologous expression in yeast: Chaetomium thermophilum GET components have been recombinantly produced in Saccharomyces cerevisiae, providing a eukaryotic expression environment that facilitates proper folding and assembly .

  • Fusion protein approach: Creating a heterodimeric fusion with truncated flexible domains (e.g., GET2 ΔN-GET1) has proven successful for structural studies .

  • Co-expression strategies: Simultaneous expression of multiple GET pathway components can enhance stability and facilitate complex formation.

What purification methods yield the highest purity and activity for recombinant GET1 protein?

For optimal purification of recombinant Ajellomyces capsulata GET1 protein, the following approach is recommended:

  • Affinity chromatography: Utilize His-tag affinity purification as the primary capture step, leveraging the N-terminal His tag .

  • Secondary purification: Implement size exclusion chromatography to remove aggregates and achieve homogeneity.

  • Quality control: Verify purity by SDS-PAGE (target: greater than 90% purity) .

  • Activity assessment: For functional studies, reconstitute the purified GET1 with partner proteins (GET2, GET3) to assess complex formation and activity.

When purifying for structural studies or functional assays involving membrane insertion, additional considerations include:

  • Selection of appropriate detergents for extraction from expression host membranes

  • Reconstitution into amphipols or nanodiscs for maintaining native-like membrane environment

  • Verification of proper folding and complex formation through biophysical techniques

How can researchers investigate the role of GET1 in pathogenicity of Ajellomyces capsulata/Histoplasma capsulatum?

While direct evidence linking GET1 to virulence in Ajellomyces capsulata/Histoplasma capsulatum is limited, researchers can employ several strategies to investigate potential connections:

  • Gene knockout/knockdown studies: Create GET1-deficient strains and assess changes in virulence factors, growth characteristics, and host interaction.

  • Host-pathogen interaction assays: Examine whether GET1 disruption affects the fungus's ability to survive within macrophages, which is critical for Histoplasma pathogenesis .

  • Cell wall composition analysis: Given that cell wall components like α-1,3-glucan are known virulence determinants in Histoplasma , researchers could investigate whether GET1 disruption affects cell wall composition or organization.

  • Protein trafficking studies: Determine if GET1 disruption impacts the localization of known virulence factors that might be tail-anchored proteins.

  • Stress response assessment: Evaluate how GET1 mutants respond to host-induced stresses, such as oxidative stress or nutritional limitation.

These approaches would help elucidate whether the fundamental cellular process mediated by GET1 indirectly contributes to pathogenicity.

What are the challenges in reconstituting a functional GET insertase complex in vitro?

Reconstituting a functional GET insertase complex in vitro presents several technical challenges:

  • Membrane protein solubilization: The GET1/GET2 components are membrane proteins requiring appropriate detergents or membrane mimetics for solubilization while maintaining native-like function.

  • Complex stoichiometry: Achieving the correct 2:2 heterotetramer arrangement of GET1/GET2 requires careful optimization of expression and purification conditions .

  • Lipid requirements: The GET1/GET2 complex is stabilized by interfacial lipid binding, necessitating identification of the optimal lipid composition for functional reconstitution .

  • Conformational dynamics: The complex exhibits conformational plasticity, making it challenging to capture functionally relevant states for mechanistic studies .

  • Substrate preparation: Preparing tail-anchored protein substrates in a membrane-insertion-competent state without aggregation requires specialized approaches.

  • Activity assays: Developing quantitative assays to measure insertion activity represents another significant challenge.

Researchers have addressed some of these challenges by using fusion proteins, employing nanodiscs with defined lipid compositions, and utilizing cryo-electron microscopy to capture different conformational states .

How can researchers address protein instability issues when working with recombinant GET1?

When encountering stability issues with recombinant Ajellomyces capsulata GET1 protein, researchers can implement several strategies:

  • Optimize buffer conditions:

    • Adjust pH (typically pH 8.0 is recommended)

    • Test different buffer systems (Tris/PBS-based buffers have been successful)

    • Incorporate stabilizing agents like trehalose (6%) or glycerol (5-50%)

  • Prevent aggregation:

    • Maintain appropriate protein concentration (0.1-1.0 mg/mL is recommended)

    • Avoid repeated freeze-thaw cycles

    • Consider adding non-ionic detergents for membrane protein stability

  • Storage optimization:

    • Prepare small aliquots for single use

    • Store at -80°C for long-term storage

    • Use working aliquots at 4°C for no more than one week

  • Co-expression or co-purification:

    • Express GET1 together with its binding partners (GET2, GET3)

    • Form complexes prior to final purification steps

  • Construct engineering:

    • Consider creating fusion proteins or truncated constructs that remove flexible regions

    • Engineer stabilizing mutations based on homology models

These approaches have proven effective in structural and functional studies of GET pathway components from various organisms .

What control experiments are essential when studying GET1 function in tail-anchored protein insertion?

When investigating GET1 function in tail-anchored protein insertion, several control experiments are crucial:

  • Protein quality controls:

    • SDS-PAGE analysis to confirm protein purity (>90% recommended)

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to assess secondary structure

    • Thermal stability assays to ensure proper folding

  • Functional controls:

    • Inactive mutants with alterations in the hydrophilic groove

    • GET3 ATPase activity assays to confirm proper GET3-GET1 interaction

    • Liposome flotation assays to verify membrane association

  • Substrate controls:

    • Model tail-anchored proteins with varying hydrophobicity

    • Mutated substrates with altered C-terminal extensions

    • Fluorescently labeled substrates for tracking insertion

  • System validation:

    • Reconstitution in different membrane mimetics (nanodiscs vs. liposomes)

    • Comparison of activity with well-characterized orthologues (e.g., yeast GET complex)

    • In vivo complementation assays to verify functional relevance

These controls help distinguish specific GET1-mediated effects from non-specific interactions or artifacts.

What are the unexplored aspects of GET1 function in fungi like Ajellomyces capsulata?

Several promising research directions remain unexplored regarding GET1 function in Ajellomyces capsulata and related fungi:

  • Pathogenesis connection: Investigating whether disruption of GET1 function affects the ability of Histoplasma capsulatum to establish infection or persist within host cells. This is particularly interesting given the importance of proper protein localization in pathogen virulence .

  • Substrate specificity: Identifying the specific tail-anchored proteins in Ajellomyces capsulata that depend on the GET pathway, and determining whether any of these are important for fungal-specific processes or pathogenicity.

  • Environmental adaptation: Examining how GET1 function might be regulated under different environmental conditions encountered by the fungus, including temperature shifts associated with dimorphic transition.

  • Evolutionary diversification: Comparative studies across different fungal species to understand how the GET pathway may have specialized in different lineages.

  • Drug targeting potential: Assessing whether structural differences between fungal and human GET machinery could provide opportunities for selective therapeutic intervention.

  • Alternative insertion pathways: Investigating the interplay between the GET pathway and other membrane protein insertion machineries in Ajellomyces capsulata.

These research directions would significantly advance our understanding of fundamental cellular processes in fungal biology and potentially reveal new therapeutic targets.

How might advances in structural biology techniques further our understanding of GET pathway mechanisms?

Emerging structural biology techniques offer promising avenues to address remaining questions about GET pathway mechanisms:

  • Time-resolved cryo-EM: This approach could capture transient intermediates during the tail-anchored protein insertion process, providing insights into the dynamic conformational changes that occur during substrate handoff from GET3 to the GET1/GET2 insertase.

  • In-cell structural studies: Techniques like cryo-electron tomography could reveal the native organization of the GET machinery in intact cells, potentially identifying additional regulatory factors or spatial organization principles.

  • Integrative structural biology: Combining cryo-EM with mass spectrometry, molecular dynamics simulations, and functional assays would provide a more comprehensive understanding of how conformational changes couple to substrate insertion.

  • Single-molecule approaches: These techniques could track individual insertion events, revealing the kinetics and potential heterogeneity in the insertion process.

  • Comparative structural analysis: Expanded structural studies across diverse organisms, including Ajellomyces capsulata, would illuminate evolutionary adaptation of the insertion mechanism.

These advanced approaches would help address key questions about how the GET insertase remodels its membrane environment, accommodates diverse substrates, and coordinates the complex insertion process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.