Recombinant Ajellomyces capsulata Protein ROT1 (ROT1)
Description
Overview of Recombinant Ajellomyces capsulata Protein ROT1 (ROT1)
Recombinant Ajellomyces capsulata Protein ROT1 (ROT1) is a full-length, recombinant protein derived from the pathogenic fungus Ajellomyces capsulata (syn. Histoplasma capsulatum). This protein, encoded by the gene ROT1, is expressed in Escherichia coli and fused with an N-terminal histidine (His) tag for purification and structural studies .
Key Properties of ROT1
| Parameter | Detail |
|---|---|
| Protein Length | Full-length mature protein (25–273 amino acids) |
| Tag | N-terminal His tag |
| Purity | >90% (SDS-PAGE confirmed) |
| Source | Ajellomyces capsulata (strain not specified) |
| UniProt ID | A6RBY1 |
| Storage | Lyophilized powder; store at -20°C/-80°C, avoid freeze-thaw cycles |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability |
Amino Acid Sequence
The ROT1 protein sequence is:
QGPADPRLTGTWTTKSMKVFTGSAFYDPIKDRLKEPLLTGISYSFTADGFYEEAYFRAIS NPTRPECPSGIMQFQHGTYRVEPNGSMILTPFDSDGRQLISNRCAGKYAEYTRYTQKEVF QRYEILIDSYNRVERLNMFQFDGSPLNPMYLAFRQPQMHPTHTLNPTHTTKGAPRATAIS ERKVNAKRAKRSEEKAAEFGFAQSPLSKNSFVKRMNYYHSRMEKLSGTDKLWWVGLIMTS VGSLALIYR .
Pathogen Background
Ajellomyces capsulata is a dimorphic fungus causing histoplasmosis, a severe respiratory and systemic disease. Its yeast phase evades host immune responses by surviving within macrophages, making protein targets critical for vaccine/drug development .
Functional Insights
While ROT1’s exact role remains uncharacterized, its full-length expression and His tag suggest utility in:
-
Structural Studies: Mapping interactions with host cells or fungal virulence factors.
-
Diagnostic Development: Serving as an antigen in serological assays to detect histoplasmosis.
-
Vaccine Research: Exploring its immunogenic potential, though current vaccine candidates focus on other proteins (e.g., beta-1,3-glucanosyltransferase, oligopeptide transporters) .
Expression and Purification
ROT1 is produced in E. coli using standard recombinant protein protocols. The His tag facilitates affinity chromatography purification, yielding >90% purity .
Limitations and Future Directions
-
Functional Data Gaps: No studies directly link ROT1 to virulence or immune evasion.
-
Cross-Reactivity Risks: Unlike heat shock proteins (e.g., Hsp60), ROT1’s non-homology to human proteins reduces autoimmunity concerns .
-
Research Priorities:
-
Immunogenicity Testing: Assessing T-cell or B-cell responses in murine models.
-
Structural Analysis: X-ray crystallography to identify binding sites for therapeutic molecules.
-
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Target Background
KEGG: aje:HCAG_07139
