Recombinant Ajellomyces capsulata Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Ajellomyces capsulata Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) is a recombinant protein derived from the pathogenic fungus Ajellomyces capsulata. It is fused with an N-terminal His-tag and expressed in E. coli for research purposes. This protein plays a critical role in the assembly of the vacuolar ATPase (V-ATPase) complex, a proton pump essential for maintaining acidic environments in cellular compartments such as lysosomes and vacuoles.

ParameterDetails
Source OrganismAjellomyces capsulata
Protein IDA6R3V7
Length108 amino acids (1-108aa)
TagN-terminal His-tag
Expression SystemE. coli
FunctionIntegral membrane protein critical for V-ATPase assembly

Gene Details:

ParameterDetails
Gene IDA6R3V7
Genomic ContextNot explicitly detailed in sources
TranscriptFull-length (1-108aa)

Protein Features:

  • Membrane Integration: Predicted to span the membrane via hydrophobic stretches.

  • Post-Translational Modifications: His-tag facilitates purification via nickel-affinity chromatography .

Experimental Uses

  1. V-ATPase Assembly Studies:

    • Recombinant VMA21 is used to investigate the molecular mechanisms of V₀ domain assembly in vitro.

    • Analogous to human VMA21, which is critical for lysosomal acidification and autophagy regulation .

  2. Structural Biology:

    • His-tagged VMA21 enables crystallization or cryo-EM studies to resolve structural interactions with V₀ subunits.

  3. Comparative Analysis:

    • Ajellomyces vs. Human VMA21:

      • Ajellomyces VMA21 (108aa) is longer than human VMA21 (101aa) but lacks the human-specific ER retrieval signal .

      • Both are essential for V₀ assembly, but human VMA21 deficiencies cause X-linked myopathy with excessive autophagy (XMEA) .

Table 2: Comparative Analysis of VMA21 Across Organisms

OrganismLength (aa)ER Retention MotifDisease AssociationKey References
Ajellomyces108AbsentNone reported
Homo sapiens101Present (ER/Golgi)XMEA, Liver Disease
S. cerevisiae85KKXX (yeast-specific)V-ATPase dysfunction

Challenges and Future Directions

  1. Functional Redundancy:

    • The absence of disease associations in Ajellomyces contrasts with human VMA21-linked pathologies, suggesting species-specific regulatory mechanisms .

  2. Mechanistic Gaps:

    • How Ajellomyces VMA21 compensates for the lack of an ER retrieval motif remains unclear. Studies on yeast Vma21p may provide insights .

  3. Therapeutic Potential:

    • Recombinant VMA21 could serve as a tool to study V-ATPase-targeted therapies for fungal infections or lysosomal disorders .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in the order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, we recommend storing working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
VMA21; HCAG_04315; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)
Target Names
VMA21
Target Protein Sequence
MASRRSAAAKKEDFSFEAAATQSAHEAQEGFPSSVIIKLVLVTVAMICAPLGTYFGTLNT ICGGDSSYAGALAAISVNVVLIIYLIIAAREDTGESEEERKGKEGKEE
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the primary function of VMA21 in cellular physiology?

VMA21 serves as an essential assembly factor for the V0 domain of the vacuolar H+-ATPase (V-ATPase) complex. It plays a critical role in coordinating the assembly of V0 subunits and escorting the assembled V0 complex into endoplasmic reticulum-derived transport vesicles. VMA21 is necessary for intracellular pH homeostasis by ensuring proper V-ATPase function, which is responsible for acidification of intracellular compartments. In yeast models, VMA21 has been shown to mediate binding of V0 subunits through the proteolipid subunit Vma11p, with assembly occurring in a defined sequence where Vph1p recruitment into the Vma21p/proteolipid/Vma6p complex represents the final assembly step .

How does VMA21 deficiency affect cellular processes?

VMA21 deficiency leads to multiple cellular dysfunctions, primarily through V-ATPase misassembly and dysfunction. This results in impaired lysosomal acidification and compromised degradation of phagocytosed materials, causing lipid droplet accumulation in autolysosomes. Additionally, VMA21 deficiency triggers endoplasmic reticulum (ER) stress and sequestration of unesterified cholesterol in lysosomes, which activates sterol response element-binding protein-mediated cholesterol synthesis pathways. These mechanisms collectively contribute to pathological conditions such as autophagic myopathy and hepatopathy .

What structural characteristics of VMA21 are important for its assembly factor function?

VMA21 is an integral membrane protein that interacts with multiple V0 domain subunits. Research in Saccharomyces cerevisiae has demonstrated that VMA21 contains an ER-retrieval signal that is crucial for its normal cycling between the ER and other cellular compartments. When this retrieval signal is removed experimentally, VMA21 remains associated with the V0 complex and can be detected in the vacuole, although this altered localization does not affect the assembly of functional V-ATPase complexes. The protein's ability to bind proteolipid subunits is independent of the Vph1p (100-kDa V0 subunit) but is crucial for recruiting other components into the assembly complex .

What is the evidence for VMA21's role as a tumor suppressor in cancer research?

VMA21 demonstrates significant potential as a tumor suppressor, particularly in colorectal cancer (CRC). Analysis of The Cancer Genome Atlas (TCGA) data revealed that VMA21 is upregulated in colorectal cancerous tissues compared to adjacent normal tissues at both mRNA and protein levels. Despite this upregulation, higher VMA21 expression correlates with favorable clinical outcomes. Patients with high VMA21 expression showed higher differentiation grades and longer disease-specific survival (DSS) at stages I-III disease. Multivariate Cox analysis established high VMA21 expression as an independent predictor of DSS with a hazard ratio of 0.345 (95% confidence interval, 0.123-0.976). Functional studies demonstrated that VMA21 overexpression decreased CRC growth, while VMA21 knockdown increased CRC growth both in vitro and in vivo, providing mechanistic evidence for its tumor-suppressive properties .

How does VMA21 deficiency contribute to different clinical manifestations?

VMA21 deficiency manifests in distinct clinical entities depending on the affected tissue and severity of dysfunction. In X-linked myopathy with excessive autophagy (XMEA), VMA21 mutations lead to progressive vacuolization and atrophy of skeletal muscle. This condition can present with variable severity, from a milder form with onset after age 5 and slow progression to a severe prenatal/neonatal presentation with congenital autophagic vacuolar myopathy and potential infant mortality. Recent research has expanded the clinical spectrum to include autophagic hepatopathy characterized by steatohepatitis and chronic hypertransaminasemia. Affected patients may also display mild cholestasis, elevation of low-density lipoprotein cholesterol, and hepatic steatosis, accompanied by abnormal protein glycosylation detectable in serum. This demonstrates that VMA21 deficiency can affect multiple organ systems through disruption of autophagy processes .

Can VMA21 function be implicated in fungal pathogenesis and antifungal susceptibility?

V-ATPase function, which requires proper assembly mediated by factors like VMA21, is critical for fungal viability and pathogenicity. In pathogenic fungi, V-ATPase maintains intracellular ion homeostasis by preserving acidic pH within cellular compartments. Research with Candida glabrata demonstrated that disruption of V-ATPase assembly through deletion of VPH2 (another V-ATPase assembly factor) resulted in impaired pH homeostasis, increased sensitivity to environmental stresses, and reduced virulence in a mouse model of disseminated candidiasis. Pharmacological inhibition of V-ATPase with bafilomycin B1 showed synergistic effects with azole antifungal agents. While not specifically studied in Ajellomyces capsulata, these findings suggest that targeting VMA21 and other V-ATPase assembly components could represent a promising approach for novel antifungal strategies against various fungal pathogens .

What are the optimal approaches for expressing and purifying recombinant VMA21?

For effective expression and purification of recombinant Ajellomyces capsulata VMA21, researchers should consider the following methodological approach:

  • Expression system selection: Given VMA21's role as an integral membrane protein, expression systems capable of proper membrane protein folding and post-translational modifications are preferable. Consider:

    • Yeast expression systems (P. pastoris or S. cerevisiae) which provide natural eukaryotic folding machinery

    • Insect cell expression systems (Sf9 or High Five cells) using baculovirus vectors

    • Mammalian cell expression for highest fidelity to native structure

  • Construct design:

    • Include affinity tags (His6, FLAG, or Strep-tag II) for purification

    • Consider fusion partners to enhance solubility

    • Engineer TEV protease cleavage sites for tag removal

    • Codon optimization for the expression host

  • Solubilization and purification:

    • Use gentle detergents (DDM, LMNG, or digitonin) for membrane extraction

    • Employ affinity chromatography followed by size exclusion chromatography

    • Consider lipid nanodisc or amphipol reconstitution for functional studies

Verification of proper folding can be performed through circular dichroism spectroscopy, while functional assessment requires reconstitution into liposomes followed by V-ATPase assembly assays .

What cellular assays can effectively measure VMA21 function in V-ATPase assembly?

To assess VMA21 function in V-ATPase assembly, researchers can employ multiple complementary approaches:

  • Co-immunoprecipitation assays: This technique allows detection of protein-protein interactions between VMA21 and V0 subunits. As demonstrated in yeast studies, immunoprecipitation of VMA21 from wild-type membranes results in co-immunoprecipitation of all five V0 subunits, providing evidence for its role in complex assembly .

  • Lysosomal acidification assays: Since V-ATPase is responsible for acidification of cellular compartments, lysosomal pH can be measured using pH-sensitive fluorescent dyes (LysoSensor, LysoTracker) or ratiometric probes to assess functional consequences of VMA21 manipulation.

  • COPII vesicle budding assays: An in vitro assay for ER export can demonstrate the preferential packaging of fully assembled Vma21p/proteolipid/Vma6p/Vph1p complexes into COPII-coated transport vesicles, revealing insights into VMA21's role in V0 transport .

  • Pulse-chase experiments: These experiments can track the transient interaction between VMA21 and V0, showing how VMA21/V0 dissociation coincides with V0/V1 assembly, providing temporal insights into the assembly process .

  • Autophagy flux measurement: Given VMA21's role in autophagy, monitoring LC3-II levels with and without lysosomal inhibitors can assess autophagic function downstream of V-ATPase assembly.

How can researchers effectively introduce mutations in VMA21 for structure-function studies?

For structure-function analysis of VMA21, researchers should implement a systematic mutagenesis strategy:

  • Site-directed mutagenesis approaches:

    • Alanine scanning: Systematically replace conserved residues with alanine

    • Charge reversal: Convert negatively charged residues to positively charged ones and vice versa

    • Domain swapping: Exchange domains between VMA21 homologs from different species

    • Deletion analysis: Remove specific protein regions to determine essential domains

  • CRISPR/Cas9 genome editing:

    • For cellular studies, introduce mutations at the genomic level

    • Generate isogenic cell lines differing only in VMA21 sequence

    • Create conditional knockout models using floxed alleles

  • Functional readouts:

    • Assess V-ATPase assembly using biochemical assays

    • Measure lysosomal acidification

    • Evaluate autophagy flux

    • Monitor cell growth under stress conditions

  • Structural visualization:

    • Employ cryogenic electron microscopy to visualize how mutations affect VMA21's interaction with V0 subunits

    • Use cross-linking mass spectrometry to map interaction interfaces

Disease-associated mutations provide particularly valuable targets for analysis, as they likely affect critical functional domains of the protein .

How can recombinant VMA21 be utilized for high-throughput drug screening platforms?

Developing high-throughput screening (HTS) platforms using recombinant Ajellomyces capsulata VMA21 requires careful assay design:

Assay System Development:

  • Binding assays: Fluorescently labeled VMA21 can be used to measure binding to V0 subunits. Compounds that disrupt this interaction could be identified using fluorescence polarization or FRET-based techniques.

  • Functional reconstitution: Recombinant VMA21 can be incorporated into artificial membrane systems with V0 components to measure assembly efficiency using FRET pairs positioned on different subunits.

  • Cellular reporter systems: Engineer cell lines expressing VMA21 fused to split luciferase reporters that activate when proper V-ATPase assembly occurs.

Screening Implementation:

  • Primary screen: Use the simplest assay format with recombinant proteins to screen large compound libraries (10,000-100,000 compounds)

  • Secondary validation: Confirm hits in cellular assays measuring V-ATPase assembly

  • Tertiary assessment: Evaluate effects on cellular processes dependent on V-ATPase function

Validation Methodologies:

  • Surface plasmon resonance: Confirm direct binding and measure kinetics

  • Isothermal titration calorimetry: Determine thermodynamic parameters

  • Cellular thermal shift assay: Verify target engagement in cells

This approach could identify compounds that specifically modulate VMA21 function for both basic research and therapeutic development targeting fungal pathogens .

What are the challenges in designing recombinant VMA21 constructs for structural studies?

Structural studies of membrane proteins like VMA21 present significant challenges:

Fundamental Challenges:

ChallengeDescriptionPotential Solutions
Membrane protein instabilityVMA21 requires a lipid environment for stabilityUse of specialized detergents (LMNG, GDN); Lipid nanodiscs; Amphipols
Conformational heterogeneityMultiple functional states complicate structural determinationEngineering conformationally-stabilized mutants; Use of conformation-specific antibodies
Low expression yieldsMembrane proteins often express poorlyScreening multiple expression systems; Fusion with well-expressed partners (e.g., BRIL, T4 lysozyme)
Crystallization difficultiesDetergent micelles limit crystal contactsLCP crystallization; Antibody-mediated crystallization; Focus on cryo-EM approaches

Construct Design Considerations:

  • Removal of flexible regions that might impede crystallization while preserving functional domains

  • Introduction of thermostabilizing mutations identified through alanine scanning

  • Fusion with crystallization chaperones like T4 lysozyme or BRIL

  • Surface entropy reduction through mutation of surface-exposed lysine/glutamate patches

Recent Technological Advances:

  • Cryo-EM: Single particle analysis has revolutionized membrane protein structural biology

  • AlphaFold2 and RoseTTAFold: AI-based structure prediction can guide construct design

  • X-ray free electron lasers: Allow structure determination from microcrystals

The most promising approach may be to capture VMA21 in complex with its binding partners from the V0 domain for cryo-EM analysis, possibly using stabilizing nanobodies .

How can researchers investigate VMA21 interactions with the fungal secretory pathway?

Investigating VMA21 interactions with the fungal secretory pathway requires specialized approaches:

Experimental Strategies:

  • Proximity labeling techniques:

    • BioID or TurboID fusion with VMA21 to identify proximal proteins in the secretory pathway

    • APEX2 labeling combined with mass spectrometry to map the VMA21 interactome in different cellular compartments

  • Live-cell trafficking studies:

    • Fluorescent protein tagging of VMA21 (ensuring functionality is preserved)

    • Photoactivatable or photoconvertible tags to track protein movement between compartments

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility and residency time

  • ER-Golgi trafficking assays:

    • Vesicle budding assays using recombinant COPII components

    • In vitro reconstitution of ER-to-Golgi transport with purified components

    • Temperature-sensitive trafficking mutants to create synchronized trafficking waves

  • Organelle isolation and biochemical characterization:

    • Density gradient fractionation to isolate specific secretory compartments

    • Immuno-isolation of specific vesicle populations

    • Proteomic analysis of isolated compartments to identify VMA21-associated proteins

Research in yeast has demonstrated that VMA21 facilitates the preferential packaging of assembled V0 complexes into COPII vesicles, and blocking ER export stabilizes VMA21/V0 interactions. Similar studies in fungal systems would reveal whether Ajellomyces capsulata VMA21 employs similar trafficking mechanisms and identify potential fungal-specific interactions that could be targeted therapeutically .

How does fungal VMA21 differ from mammalian homologs in structure and function?

Comparative analysis of fungal and mammalian VMA21 reveals important distinctions with research implications:

Evolutionary Conservation and Divergence:
While the core function of VMA21 as a V-ATPase assembly factor is conserved across species, significant differences exist between fungal and mammalian homologs:

  • Sequence divergence: Phylogenetic analysis shows that fungal VMA21 proteins, including those from Ajellomyces capsulata, typically share 30-40% sequence identity with human VMA21, with conservation concentrated in functional domains involved in V0 interaction.

  • Localization signals: Mammalian VMA21 contains specialized trafficking signals for retention in the ER-Golgi intermediate compartment, while fungal homologs may utilize different trafficking mechanisms. In yeast, VMA21 contains an ER-retrieval signal critical for its cycling between compartments .

  • Interaction partners: The V-ATPase complex components show species-specific variations that necessitate corresponding adaptations in assembly factors. Fungal VMA21 has co-evolved with fungal-specific V0 subunits.

  • Disease implications: Human VMA21 mutations cause X-linked myopathy with excessive autophagy and autophagic hepatopathy, while in fungi, VMA21 dysfunction affects virulence and stress responses .

These differences provide potential targets for selective therapeutic intervention in fungal infections.

What insights from cancer research on VMA21 can be applied to studying fungal pathogenesis?

Cancer research on VMA21 offers valuable translational insights for fungal pathogenesis studies:

Shared Mechanisms and Translational Opportunities:

  • Metabolic reprogramming: Studies showing VMA21's role in colorectal cancer growth regulation suggest examining how fungal VMA21 might regulate metabolic adaptation during infection. Cancer cells and pathogenic fungi both must adapt their metabolism to hostile environments .

  • Autophagy modulation: The role of VMA21 in autophagic processes in cancer cells parallels the importance of autophagy in fungal stress responses and virulence. Research methodologies used to study autophagy in cancer models can be adapted for fungal systems .

  • pH homeostasis: Cancer cells often exhibit altered pH regulation, and VMA21's role in V-ATPase assembly influences this process. Similarly, fungi must maintain pH homeostasis during infection, particularly when encountering host defense mechanisms .

  • Drug development approaches: Strategies targeting VMA21 or V-ATPase function in cancer might be repurposed for antifungal development. The synergistic interaction between V-ATPase inhibitors and azole antifungals observed in Candida suggests similar combination strategies could be effective against Ajellomyces capsulata .

  • Biomarker potential: Just as VMA21 expression serves as a prognostic marker in colorectal cancer, measuring fungal VMA21 expression levels during infection might provide indicators of disease progression or treatment response .

How can advanced molecular dynamics simulations contribute to understanding VMA21 function?

Molecular dynamics (MD) simulations provide powerful insights into VMA21 function at the atomic level:

Simulation Approaches and Their Applications:

  • Membrane protein simulation techniques:

    • All-atom MD simulations in explicit lipid bilayers can model VMA21's natural environment

    • Coarse-grained simulations allow longer timescales to observe large conformational changes

    • Enhanced sampling methods (metadynamics, umbrella sampling) can explore energy landscapes

  • Key research questions addressable through simulation:

    • Conformational changes during V0 subunit binding and release

    • Lipid-protein interactions that stabilize VMA21 in membranes

    • Effects of disease-causing mutations on protein stability and dynamics

    • Identification of cryptic binding pockets for drug design

  • Integration with experimental data:

    • Cryo-EM density maps can guide initial model building

    • Crosslinking mass spectrometry data can provide distance constraints

    • Mutagenesis results can validate simulation-derived hypotheses

  • Practical implementation:

    • Start with homology models based on known structures or AlphaFold2 predictions

    • Embed models in representative membrane compositions

    • Run replicate simulations to ensure statistical significance

    • Analyze trajectories for stable interactions, water networks, and conformational ensembles

Recent advances in GPU computing and specialized software (AMBER, GROMACS, NAMD) make these simulations increasingly accessible to research laboratories, providing testable hypotheses about VMA21 function that can guide experimental design .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.