Recombinant Ajellomyces dermatitidis Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Characteristics of LCL3

LCL3 is described as a putative protein with an unknown function, but it shows homology to Staphylococcus aureus nuclease . The full-length recombinant LCL3 protein consists of 303 amino acids .

Blastomycosis and Ajellomyces dermatitidis

Blastomyces dermatitidis is found in parts of eastern North America, Africa, the Arabian Peninsula, and the Indian subcontinent . The fungus lives in soil and wet, decaying wood, often near waterways . Blastomycosis begins with a subtle pneumonia-like infection and can progress to a disseminated phase, causing lesions in the skin, internal organs, central nervous system, and bone marrow . Infection occurs through inhalation of conidia (spores) .

Intracellular Lifestyle of Blastomyces dermatitidis

Research indicates that Blastomyces dermatitidis has an unappreciated facultative intracellular lifestyle during the early stages of infection . Spores of B. dermatitidis are taken up by alveolar macrophages in the lungs, where they convert to yeast and replicate intracellularly . This intracellular residence and replication in macrophages is required for the initiation of disease .

Role of Phagocytes in Blastomycosis

Alveolar macrophages, neutrophils, and monocytes provide natural resistance to infection with conidia of B. dermatitidis . Alveolar macrophages can inhibit the transformation of conidia to the pathogenic yeast form, which is a critical step in pathogenesis . Polymorphonuclear leukocytes handle inhaled conidia better than macrophages but are relatively ineffective against yeast forms .

Research Findings

  • Intracellular Replication: Studies have shown that spores are rapidly taken up into alveolar macrophages, where they convert to yeast and replicate intracellularly .

  • Macrophage Depletion: Depletion of alveolar macrophages curtailed infection in mice infected with spores and led to a 26-fold reduction in lung CFU by 6 days post-infection compared to non-depleted mice .

  • Phase Transition: Spores cultured in vitro converted to yeast faster in the presence of macrophages than in medium alone .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
LCL3; BDCG_01496; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis)
Target Names
LCL3
Target Protein Sequence
MPWLFWSSGSQRQMSSNENNTDKTTPIVGETNSSSSSTQCANCSTPITTPPTDTSNQVNP PHQTHRPPALDWNASLATRDWAGDFKDPRNLIPTLLLTSGILFCVRIHRKYLRRIPVATS ISPTYFHKRSIFGRVTSVGDGDNFRLFHTPGGRLAGWEWLPFRKVPTAKKELKDRTIHIR LAGVDAPELPHFGRPAQPYSDAAHTWLTTYLLNRRVRAYVYRQDQYGRVVATVYVRRWPF PFIRRDVGLQMLRAGLAPVNEAKTGVDFGGEGTGRRLPPRGGKGEEPPEGDLEGEGGFRG GES
Uniprot No.

Target Background

Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Ajellomyces dermatitidis and how does it relate to Blastomyces dermatitidis?

Ajellomyces dermatitidis is the sexual (teleomorph) form of the dimorphic fungal pathogen Blastomyces dermatitidis. Recent taxonomic studies have led to reclassification of strains within this group, with recognition of at least two distinct species: B. dermatitidis and B. gilchristii. Blastomyces causes blastomycosis, a geographically widespread systemic mycosis of humans and other mammals that is most common in North America, particularly endemic to the Ohio and Mississippi River Valley regions . The organism exists as a mold in the environment but converts to a pathogenic yeast form at body temperature in host tissues. This dimorphic capability is crucial to its virulence potential .

What expression systems are used for recombinant LCL3 production?

The recombinant LCL3 protein is typically expressed in E. coli expression systems. Commercial preparations often include an N-terminal His-tag to facilitate purification . The full-length protein (amino acids 1-303) is expressed to maintain complete functionality. The protein requires careful handling after purification and is typically supplied in a Tris-based buffer with 50% glycerol to enhance stability . For research applications, the recombinant protein should be stored at -20°C/-80°C, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that may compromise activity .

What methodological approaches are recommended for studying LCL3's endonuclease activity?

To investigate the endonuclease activity of recombinant LCL3, researchers should consider:

  • Substrate selection: Use a variety of DNA substrates (circular/linear, single/double-stranded) to determine substrate preference.

  • Reaction conditions: Test activity under different pH, temperature, and ionic strength conditions, particularly considering that Blastomyces is a thermally dimorphic fungus that transitions between environmental (25°C) and host (37°C) temperatures.

  • Metal ion dependence: Assess the requirement for specific divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺) that often serve as cofactors for endonucleases.

  • Kinetic analysis: Determine enzyme kinetics parameters (Km, Vmax) to understand substrate affinity and catalytic efficiency.

  • Inhibition studies: Evaluate the effect of potential inhibitors to characterize the active site.

The optimization of these conditions should consider that the enzyme originates from a dimorphic fungus that exists in different forms at different temperatures, which may affect protein structure and function .

How does LCL3 compare to similar endonucleases in other fungi?

LCL3 appears to be conserved across various fungal species. The search results indicate that probable endonuclease LCL3 homologs exist in other fungi, including Uncinocarpus reesii and Leptosphaeria maculans . A comprehensive comparison would involve:

  • Sequence alignment: Compare amino acid sequences to identify conserved domains and motifs.

  • Phylogenetic analysis: Determine evolutionary relationships between LCL3 homologs.

  • Structural prediction: Use computational tools to predict and compare protein structures.

  • Functional characterization: Compare enzymatic properties and substrate specificities.

Such comparative studies would provide insights into the evolution of this endonuclease family and its potential specialized functions in different fungal species.

What experimental design would be optimal for investigating potential roles of LCL3 in fungal cell wall metabolism?

Given that studies have examined cell wall composition and enzyme interactions in Blastomyces dermatitidis , investigating LCL3's potential involvement in cell wall metabolism would require:

  • Localization studies: Determine if LCL3 localizes to the cell wall or is secreted.

  • Knockout/knockdown experiments: Generate LCL3-deficient strains to observe effects on cell wall structure and integrity.

  • Cell wall isolation: Isolate purified cell walls from wild-type and LCL3-deficient strains for compositional analysis.

  • Enzymatic assays: Test if LCL3 can hydrolyze any cell wall components, particularly nucleic acid components that might be present in extracellular matrices.

  • Dimorphic transition studies: Examine whether LCL3 expression changes during the mold-to-yeast transition, which involves significant cell wall remodeling.

This approach would help determine if LCL3 plays any role beyond its predicted nuclease activity, potentially contributing to the unique properties of the Blastomyces cell wall that have been shown to differ from those of related fungi such as Histoplasma capsulatum .

How can recombinant LCL3 be utilized for development of diagnostic or therapeutic approaches for blastomycosis?

Development of novel diagnostics or therapeutics targeting LCL3 would involve:

  • Antigenicity assessment: Determine if LCL3 is immunogenic during infection and if antibodies against it can serve as diagnostic markers.

  • Specificity analysis: Compare LCL3 sequence and structure with host proteins to identify fungal-specific features that could be targeted.

  • Inhibitor screening: Develop high-throughput assays to identify small molecules that specifically inhibit LCL3 activity.

  • Structure-based drug design: If crystal structure becomes available, use it for rational design of inhibitors.

  • Vaccine potential: Evaluate if recombinant LCL3 or epitopes derived from it could serve as vaccine components.

Given the expanding global recognition of dimorphic fungal infections and the limited treatment options currently available, novel targets like LCL3 warrant investigation .

What are the optimal conditions for maintaining recombinant LCL3 stability and activity?

To maintain stability and activity of recombinant LCL3:

  • Storage buffer optimization: The protein is typically supplied in a Tris-based buffer with 50% glycerol at pH 8.0, which helps maintain stability .

  • Temperature considerations: Store stock at -20°C/-80°C for long-term storage, with working aliquots at 4°C for up to one week .

  • Freeze-thaw cycles: Minimize freeze-thaw cycles as they can significantly reduce enzymatic activity .

  • Reconstitution protocol: For lyophilized preparations, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 5-50% for long-term storage .

  • Activity assays: Regularly verify enzymatic activity using appropriate substrates before critical experiments.

These conditions are specifically optimized for the recombinant His-tagged LCL3 protein expressed in E. coli systems .

What methods can be used to investigate LCL3 expression during different stages of Blastomyces infection?

To study LCL3 expression during infection:

  • Transcriptomic analysis: RNA-seq can be performed on Blastomyces cells isolated from infected tissues, similar to approaches used to identify the 72 genes upregulated during mouse infection .

  • RT-qPCR: Quantitative PCR can provide more targeted analysis of LCL3 expression levels across different conditions.

  • Reporter systems: Development of LCL3 promoter-reporter constructs (e.g., GFP) for visualization of expression in vitro and potentially in vivo.

  • Proteomics: Mass spectrometry-based approaches to detect LCL3 protein in fungal cells isolated from infection models.

  • Immunological detection: Generation of specific antibodies against LCL3 for immunohistochemistry or Western blot analysis.

Studies have shown that gene expression in Blastomyces can vary significantly between in vitro culture and in vivo infection conditions, making these comparative approaches particularly valuable .

How does LCL3 function compare between virulent and avirulent Blastomyces strains?

To investigate potential differences in LCL3 between virulent (e.g., B. gilchristii SLH14081) and avirulent (e.g., B. dermatitidis ER-3) strains:

  • Sequence comparison: Analyze if there are amino acid variations that might affect function.

  • Expression analysis: Compare LCL3 expression levels between strains during growth and infection.

  • Protein activity assays: Directly compare enzymatic activities of recombinant LCL3 from different strains.

  • Complementation studies: Introduce LCL3 from virulent strains into avirulent strains to assess impact on virulence.

Research has shown significant genomic differences between these strains, with the virulent B. gilchristii strain SLH14081 having a larger genome (75.4 Mb) compared to the avirulent B. dermatitidis strain ER-3 (66.6 Mb) . These differences may extend to the regulation or function of proteins like LCL3.

What is the evolutionary relationship of LCL3 across the Ajellomycetaceae family?

Evolutionary analysis of LCL3 would involve:

  • Comparative genomics: Compare LCL3 sequences across Blastomyces, Histoplasma, Emmonsia, and other related fungi.

  • Evolutionary rate analysis: Determine if LCL3 is under selective pressure that might indicate functional importance.

  • Synteny analysis: Examine conservation of genomic context around the LCL3 gene.

  • Domain architecture: Analyze if domain organization is conserved across species.

The Ajellomycetaceae family includes several important pathogens with varying host ranges and virulence mechanisms . Understanding the evolution of proteins like LCL3 could provide insights into adaptation to different ecological niches and hosts.

How can structural biology approaches enhance our understanding of LCL3 function?

Advanced structural biology methods to investigate LCL3 include:

  • X-ray crystallography: Determine the three-dimensional structure of the protein, providing insights into catalytic mechanisms.

  • NMR spectroscopy: Study protein dynamics and interactions with substrates in solution.

  • Cryo-electron microscopy: Visualize larger complexes involving LCL3.

  • Molecular dynamics simulations: Model protein behavior under different conditions.

  • Structure-function relationship studies: Create targeted mutations based on structural data to validate the roles of specific residues.

The amino acid sequence of LCL3 (303 amino acids) suggests it is amenable to these structural biology approaches , which could significantly advance understanding of its enzymatic mechanism.

What experimental approaches would best elucidate the substrate specificity of LCL3?

To determine LCL3 substrate specificity:

  • Substrate screening: Test activity against various DNA/RNA structures (linear, circular, single-stranded, double-stranded, different sequences).

  • Cleavage site mapping: Sequence products to identify precise cut sites and potential sequence preferences.

  • Competitive assays: Perform competition experiments between different substrates.

  • Site-directed mutagenesis: Modify potential substrate recognition residues to confirm their role.

  • Structure determination with bound substrate analogs: Directly visualize substrate binding mode.

Understanding substrate specificity would help determine whether LCL3 has a general endonuclease function or targets specific sequences or structures, which could illuminate its biological role.

What methodological challenges exist in studying the potential role of LCL3 in fungal pathogenesis?

Researchers face several challenges when investigating LCL3's role in pathogenesis:

  • Genetic manipulation difficulties: Blastomyces can be challenging to transform and manipulate genetically compared to model fungi.

  • Biosafety considerations: Work with pathogenic Blastomyces requires appropriate containment facilities.

  • Dimorphic complexity: The fungus exists in different forms at different temperatures, complicating experimental design.

  • Animal models: Ensuring animal models accurately reflect human disease progression.

  • Protein purification challenges: Maintaining endonuclease activity through purification processes.

Studies of Blastomyces have shown that phenotypic traits can be difficult to standardize, as noted in research attempting to characterize spore production , highlighting the technical challenges in this field.

How might LCL3 contribute to the adaptation of Blastomyces to different environmental conditions?

As a dimorphic fungus, Blastomyces must adapt to drastically different environments:

  • Transcriptional profiling: Compare LCL3 expression between environmental and host conditions.

  • Temperature-dependent activity: Characterize how LCL3 function changes across temperature ranges.

  • Stress response: Determine if LCL3 expression or activity is altered during various stress conditions.

  • Environmental sampling: Examine LCL3 sequence variation in environmental isolates from different geographical regions.

  • Protein stability studies: Assess how temperature and pH affect LCL3 structure and function.

The dimorphic nature of Blastomyces involves significant transcriptional reprogramming during the transition between morphotypes , and understanding LCL3's potential role in this process could provide important insights into adaptation mechanisms.

What are the implications of LCL3 for antifungal drug development?

The potential of LCL3 as a drug target should be evaluated through:

  • Essentiality studies: Determine if LCL3 is essential for Blastomyces survival or virulence.

  • Comparative analysis: Assess differences between fungal LCL3 and any human homologs to identify selective targeting opportunities.

  • High-throughput screening: Develop assays suitable for screening compound libraries against LCL3 activity.

  • In silico drug design: Use structural information for virtual screening of potential inhibitors.

  • Synergistic potential: Evaluate if LCL3 inhibition could enhance activity of existing antifungals.

Recent antifungal susceptibility studies on emerging dimorphic pathogens, including Blastomyces species, highlight the need for new therapeutic targets as some strains show elevated MICs to current antifungals like amphotericin B .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.