Recombinant Ajellomyces dermatitidis Protein GET1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET1; BDBG_06196; Protein GET1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Blastomyces gilchristii (strain SLH14081) (Blastomyces dermatitidis)
Target Names
GET1
Target Protein Sequence
MPSLLITILLLNIVIYVINTIGAATIDSLLWLFYIKLPTGTSHMAREQRRLKREVIQLKR EMNATSSQDEFAKWAKLRRRHDKALETYEAKNNELTQCKSSFDMTVKSVRWAATSGLMLF LQFWYSKRPIFTLPPGWIPWQVQWVLSFPRAPMGTVSIQIWGGACATVVALVGDAVGATM GFVSASKKEGMKVGAGVGEKEGKKSQ
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Foundational Considerations

Recombinant GET1 production requires careful selection of expression systems to preserve post-translational modifications critical for its biological activity. For example:

  • Expression Systems: Use eukaryotic systems (e.g., Pichia pastoris or HEK293 cells) to ensure proper glycosylation.

  • Purification: Employ affinity chromatography (e.g., His-tag purification) followed by size-exclusion chromatography to confirm monomeric stability.

  • Validation: Verify structural integrity via circular dichroism (CD) spectroscopy and SDS-PAGE under reducing/non-reducing conditions.

Data-Driven Example:

ParameterWild-Type BAD1 Recombinant GET1 (Hypothetical)
Expression Yield25 mg/L in yeastOptimized via codon adaptation
GlycosylationYesConfirmed via lectin blot
Functional ActivityTNF-α suppressionTBD via phagocyte assays

Advanced Mechanistic Analysis

Conflicting data often arise when recombinant proteins exhibit divergent behaviors across experimental models. For instance, BAD1 suppresses TNF-α via TGF-β in vitro but employs TGF-β-independent mechanisms in vivo . To address this for GET1:

  • Comparative Models:

    • In Vitro: Use primary murine macrophages/neutrophils to assess cytokine modulation (e.g., TNF-α, TGF-β) via ELISA.

    • In Vivo: Deploy murine pulmonary infection models with GET1-knockout strains and monitor cytokine dynamics via bronchoalveolar lavage.

  • Neutralization Studies:

    • Apply TGF-β-blocking antibodies (e.g., anti-TGF-β mAb 1D11.16) to isolate cytokine-specific effects .

  • Soluble vs. Surface-Bound Protein:

    • Test whether soluble GET1 (mimicking in vivo release) and yeast-bound GET1 induce distinct immune responses.

Case Study from BAD1 :

ConditionTGF-β DependenceTNF-α Suppression Efficacy
Surface-Bound BAD1Yes90% reduction
Soluble BAD1No70% reduction

Foundational Approaches

  • Phagocyte Interaction Assays:

    • Coculture GET1-expressing yeast with murine macrophages and quantify TNF-α/TGF-β via multiplex assays.

    • Compare results to GET1-knockout strains to isolate protein-specific effects.

  • Neutralization/Depletion:

    • Use siRNA or CRISPR-Cas9 to silence TGF-β receptors on phagocytes and assess GET1’s residual immunosuppressive activity.

Advanced Techniques

  • Spatiotemporal Protein Localization:

    • Apply immunofluorescence microscopy to track GET1 release in vivo using alveolar lavage fluid from infected mice.

  • Proteomic Profiling:

    • Identify host proteins interacting with GET1 via co-immunoprecipitation followed by mass spectrometry.

Hypothesis-Driven Framework

  • Identify Confounding Variables:

    • Strain-specific differences (e.g., GET1 expression levels across Ajellomyces isolates).

    • Temporal factors (e.g., early vs. late infection cytokine cascades).

  • Leverage Dual Mechanisms:

    • BAD1 suppresses TNF-α through both TGF-β-dependent (surface-bound) and -independent (soluble) pathways . Similarly, design experiments to dissect GET1’s bifunctionality.

Experimental Workflow:

  • In Vitro Neutralization: Treat phagocytes with anti-TGF-β mAb and measure residual GET1-mediated TNF-α suppression.

  • In Vivo Soluble Protein Quantification: Use longitudinal alveolar lavage to correlate GET1 levels with cytokine profiles.

Technical Complexities

  • Compartment-Specific Effects: Lung alveoli (site of initial infection) may concentrate soluble GET1, altering local vs. systemic immune responses.

  • Host Genetic Variability: Use transgenic murine models (e.g., TNF-α⁻/⁻) to isolate GET1’s contribution to pathogenicity.

Lessons from BAD1 :

ModelKey FindingImplication for GET1 Studies
Murine neutrophilsTGF-β reduces fungal killing by 100%Test GET1’s impact on phagocyte efficacy
Adenovirus TGF-βNo exacerbation of infectionAssess GET1’s TGF-β-independent roles

Methodological Pipeline

  • Domain Mapping:

    • Express truncated GET1 variants (e.g., N-terminal adhesin domains) and test binding to host receptors (e.g., CR3 integrin).

  • Mutagenesis:

    • Introduce point mutations in putative immunomodulatory regions (e.g., glycosylation sites) and assess cytokine suppression.

Example from BAD1 :

Mutation TypeTNF-α SuppressionTGF-β Induction
Wild-Type BAD190%4–5 ng/mL
Glycosylation-Deficient30%1 ng/mL

Multidisciplinary Strategies

  • Transcriptomic Profiling: Compare host gene expression in GET1-expressing vs. knockout infections.

  • In Vivo Imaging: Use bioluminescent Ajellomyces strains to correlate GET1 expression with disease progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.