Recombinant Akkermansia muciniphila ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; Amuc_0510; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
Target Names
atpF
Target Protein Sequence
MLNLIADQAWNPFAPFGVTSWEPFVANLIAFILMVVILRYLAFKPIQNVLEKRRQRIEEG EEMREESERQLASVKEQTHEMLVEAGEKGQEKIDAAKAAAARLLEEQEAEASRKAEEIIK KARQLAELEQQKEREALKEQFGQLVALAAAQVTGKMLTEEDQRRINREAIDSLDS
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in A. muciniphila metabolism?

ATP synthase subunit b is a critical component of the F₀ domain of the ATP synthase complex, which is essential for energy production in A. muciniphila. This bacterium inhabits the mucus layer of the intestinal tract and represents approximately 1-3% of the total gut microbiota in healthy adults . The atpF gene encodes the b subunit that forms part of the peripheral stalk connecting the F₁ and F₀ domains of ATP synthase. This connection is crucial for the rotational catalysis that drives ATP synthesis during oxidative phosphorylation. In A. muciniphila, ATP synthase activity is particularly important for energy generation during growth on mucin, as this bacterium can use mucin as its sole carbon and nitrogen source .

How does the expression of atpF change under different growth conditions?

Transcriptome analysis of A. muciniphila has shown that genes involved in energy metabolic pathways, including those related to ATP synthesis, are differentially regulated depending on environmental conditions. When A. muciniphila is grown in mucin-depleted conditions, most genes involved in glycolysis and energy metabolic pathways are significantly upregulated compared to mucin-containing conditions . This suggests that the absence of mucin triggers metabolic adaptation, potentially affecting ATP synthase subunit expression including atpF. This adaptation likely represents a survival strategy where the bacterium optimizes energy production under nutrient-limited conditions.

What is known about the structure of ATP synthase in A. muciniphila compared to other bacteria?

While the specific structure of A. muciniphila ATP synthase has not been fully characterized, it likely shares similarities with other bacterial F-type ATP synthases. The ATP synthase complex in bacteria typically consists of two major domains: the membrane-embedded F₀ domain (containing the a, b, and c subunits) and the catalytic F₁ domain (containing the α, β, γ, δ, and ε subunits). The b subunit, encoded by atpF, forms part of the stator stalk that prevents rotation of certain components while allowing others to rotate during ATP synthesis. The unique adaptation of A. muciniphila to the mucus environment may have led to specific structural adaptations in its ATP synthase complex to optimize function under the distinctive conditions of this ecological niche.

What are the optimal conditions for expressing recombinant A. muciniphila atpF?

For optimal expression of recombinant A. muciniphila atpF, researchers should consider the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) is typically preferred for recombinant expression of bacterial membrane proteins.

  • Growth medium optimization: Research indicates that A. muciniphila protein expression is affected by growth conditions. For the expression host, a nutrient-rich medium like LB supplemented with appropriate antibiotics is recommended, with induction at mid-log phase (OD₆₀₀ of 0.6-0.8).

  • Temperature adjustment: Lower induction temperatures (16-20°C) are often beneficial for membrane protein expression to prevent inclusion body formation.

  • Induction protocol: Use of 0.1-0.5 mM IPTG for induction, with expression continued for 16-18 hours at reduced temperature.

  • Buffer composition: For protein extraction, phosphate buffers (pH 7.4) containing 1-2% detergent (such as n-dodecyl β-D-maltoside) are effective for solubilizing membrane proteins while maintaining their structural integrity.

These conditions should be optimized specifically for atpF based on initial expression trials, as A. muciniphila proteins may have unique requirements reflecting their adaptation to the mucin-rich intestinal environment .

What purification strategies are most effective for isolating recombinant atpF protein?

A multi-step purification strategy is recommended for isolating recombinant A. muciniphila atpF protein:

  • Initial extraction: Membrane fraction isolation followed by solubilization with an appropriate detergent (n-dodecyl β-D-maltoside or CHAPS at 1-2%).

  • Affinity chromatography: His-tag affinity purification using nickel or cobalt resins with imidazole gradient elution (50-300 mM).

  • Size exclusion chromatography: To remove aggregates and achieve higher purity, using columns appropriate for membrane proteins (such as Superdex 200).

  • Ion exchange chromatography: As a polishing step, using an appropriate pH based on the theoretical pI of atpF.

  • Quality assessment: SDS-PAGE analysis combined with Western blotting using anti-His antibodies or specific antibodies against atpF.

To maintain protein stability throughout purification, all buffers should contain 10-15% glycerol and 0.05-0.1% detergent above the critical micelle concentration. This approach preserves the native conformation of the membrane protein while achieving high purity for subsequent structural and functional studies.

What techniques are most suitable for studying the interaction between atpF and other ATP synthase subunits?

Several complementary techniques are recommended for investigating interactions between atpF and other ATP synthase subunits:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpF or other subunits to pull down protein complexes, followed by Western blot analysis to identify interacting partners.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified atpF and other ATP synthase components.

  • Förster resonance energy transfer (FRET): For monitoring protein-protein interactions in real-time, particularly useful for understanding dynamic assembly processes.

  • Chemical cross-linking coupled with mass spectrometry: To identify interaction interfaces between atpF and neighboring subunits.

  • Bacterial two-hybrid system: As an in vivo approach to confirm interactions suggested by in vitro methods.

When studying membrane protein interactions like those involving atpF, careful attention to membrane mimetics (detergents, nanodiscs, or liposomes) is essential to maintain the native-like environment. Additionally, site-directed mutagenesis of key residues can provide valuable insights into the specificity and functional relevance of the identified interactions.

How can recombinant atpF be used to study A. muciniphila adaptation to different bile acid environments?

Recombinant atpF can serve as a valuable tool to investigate A. muciniphila's adaptation to bile acid environments through several experimental approaches:

  • Expression analysis: Quantify atpF expression levels in A. muciniphila cultures exposed to different bile acids using qRT-PCR and Western blotting. Research shows that A. muciniphila exhibits differential responses to various bile salts, with sodium deoxycholate uniquely promoting growth while most other bile salts inhibit growth .

  • Mutagenesis studies: Generate point mutations in key regions of atpF to identify residues critical for ATP synthase function under bile stress conditions.

  • ATP synthesis assays: Compare ATP production in wild-type versus atpF-modified strains when exposed to varying concentrations of bile acids to determine functional impact.

  • Membrane integrity assessment: Use fluorescent probes to measure membrane potential in cells expressing wild-type versus modified atpF when challenged with bile acids.

  • Protein-lipid interaction studies: Investigate how bile acids affect the interaction between atpF and membrane lipids using fluorescence anisotropy or differential scanning calorimetry.

What role might atpF play in the therapeutic effects of A. muciniphila in metabolic disorders?

The atpF subunit may contribute significantly to A. muciniphila's therapeutic effects in metabolic disorders through several potential mechanisms:

Understanding atpF's role could help optimize culture conditions for therapeutic applications, as evidenced by findings that A. muciniphila grown without mucin showed enhanced therapeutic effects, potentially due to altered protein expression profiles including those involved in energy metabolism .

How do mutations in the atpF gene affect A. muciniphila colonization and persistence in the gut?

Mutations in the atpF gene likely influence A. muciniphila colonization and persistence in the gut through several mechanisms:

  • Energy production capacity: As part of the ATP synthase complex, atpF mutations that reduce ATP synthesis efficiency would limit energy availability for critical cellular processes, potentially compromising colonization ability and competitive fitness in the gut environment.

  • Adaptation to environmental stressors: The intestinal environment contains multiple stressors including bile acids, which can inhibit A. muciniphila growth . ATP synthase function may be crucial for stress response, and atpF mutations could impair adaptation to these conditions.

  • Membrane integrity maintenance: The b subunit contributes to the structural integrity of the ATP synthase complex within the membrane. Mutations could alter membrane properties, affecting resistance to membrane-disrupting compounds in the gut. Research has shown that changes in membrane structure through inhibition of squalene synthase increased A. muciniphila's susceptibility to bile acids .

  • Mucin utilization efficiency: A. muciniphila's signature capability is its ability to use mucin as a sole carbon and nitrogen source . ATP synthase function may be linked to the efficiency of this process, with atpF mutations potentially affecting the energy required for the expression of mucin-degrading enzymes.

  • Biofilm formation and adhesion properties: ATP availability influences cellular processes including those involved in adhesion and biofilm formation, which are critical for gut colonization and persistence.

Experimental approaches using site-directed mutagenesis to create specific atpF variants, followed by colonization studies in gnotobiotic mice, would provide valuable insights into the relationship between ATP synthase function and A. muciniphila's ecological fitness in the intestinal environment.

How does atpF expression differ between A. muciniphila grown in mucin-depleted versus mucin-containing conditions?

Analysis of A. muciniphila's transcriptional response to growth conditions reveals important insights about atpF regulation:

While the search results don't specifically mention atpF regulation, this broader pattern suggests that ATP synthase components, including atpF, may be differentially expressed based on nutrient availability. This adaptation likely represents a metabolic shift to maximize energy extraction from alternative carbon sources when the preferred substrate (mucin) is absent.

The differential expression of genes involved in energy metabolism correlates with functional outcomes, as A. muciniphila grown under mucin-depleted conditions demonstrated enhanced therapeutic efficacy in high-fat diet-induced diabetic mice, more efficiently reducing obesity and improving intestinal barrier integrity compared to bacteria grown in mucin-containing conditions .

This paradoxical finding—that growth without the bacterium's preferred substrate enhances its therapeutic properties—may be related to adaptive changes in membrane proteins and secreted factors. Understanding atpF regulation within this context could provide insights into the mechanistic basis for these enhanced therapeutic effects.

What is the relationship between ATP synthase function and the production of beneficial metabolites by A. muciniphila?

The relationship between ATP synthase function and beneficial metabolite production by A. muciniphila represents a complex interplay between energy metabolism and therapeutic effects:

  • Energy-dependent metabolite synthesis: A. muciniphila produces beneficial metabolites such as propionate, which stimulates GLP-1 secretion and improves glucose metabolism . ATP synthase function, including the contribution of atpF, provides the energy needed for these biosynthetic pathways.

  • Metabolic pathway cross-regulation: The ATP/ADP ratio influenced by ATP synthase activity serves as a key regulatory signal for numerous metabolic pathways. Changes in this ratio can alter the carbon flux through various pathways, potentially affecting the profile of metabolites produced.

  • Environmental adaptation signaling: ATP synthase may function as an environmental sensor, with its activity modulated by conditions such as pH, membrane potential, and substrate availability. This sensing capability could trigger adaptive responses that alter the bacterium's metabolic output.

  • Contrasting effects under different growth conditions: Intriguingly, A. muciniphila grown in mucin-depleted conditions shows enhanced therapeutic effects despite growing in a less preferred environment . This suggests a complex relationship where metabolic stress may actually enhance the production of beneficial compounds, possibly through altered regulation of ATP synthase and other energy-generating systems.

  • Secreted protein production: The absence of mucin results in upregulation of 79 genes encoding secreted protein candidates in A. muciniphila . ATP synthase function may be critical for generating the energy required for this enhanced protein secretion, which contributes to the bacterium's beneficial effects.

Understanding how ATP synthase function calibrates with beneficial metabolite production could provide insights for optimizing growth conditions to enhance A. muciniphila's therapeutic potential.

What experimental contradictions exist regarding the role of A. muciniphila membrane proteins in health and disease?

Several experimental contradictions and complexities have emerged regarding A. muciniphila membrane proteins and their roles in health and disease:

  • Beneficial versus harmful effects: While A. muciniphila is generally considered beneficial for metabolic health , research has also found that A. muciniphila-conditioned medium can induce α-synuclein aggregation in enteroendocrine cells, which is associated with Parkinson's disease pathology . This apparent contradiction suggests context-dependent effects of A. muciniphila membrane proteins.

  • Growth condition paradox: A. muciniphila grown in mucin-depleted conditions shows enhanced therapeutic effects compared to growth in its preferred mucin-containing environment . This counterintuitive finding challenges assumptions about optimal growth conditions for probiotic applications.

  • Bile acid response variability: Most bile salts inhibit A. muciniphila growth, yet sodium deoxycholate uniquely promotes its growth . This differential response to similar compounds suggests complex membrane adaptations involving multiple systems, potentially including ATP synthase components.

  • Strain-specific effects: The composition of A. muciniphila-conditioned medium is influenced by the strain's ability to degrade mucin , suggesting that genetic variations between strains may lead to different protein expression profiles and potentially contradictory experimental results when different strains are used.

  • Protein localization ambiguities: The precise localization and interactome of membrane proteins like ATP synthase components in A. muciniphila remain incompletely characterized, leading to potential contradictions in functional studies depending on membrane preparation methods.

These contradictions highlight the need for standardized experimental approaches when studying A. muciniphila membrane proteins, including careful consideration of strain selection, growth conditions, isolation methods, and functional assays to reconcile apparently conflicting results.

What novel applications of recombinant atpF could advance A. muciniphila research?

Several innovative applications of recombinant atpF could significantly advance A. muciniphila research:

  • Development of structure-based drug design: High-resolution structural characterization of recombinant atpF could enable the design of small molecules that specifically target or enhance ATP synthase function in A. muciniphila, potentially modulating its metabolic activity for therapeutic purposes.

  • Creation of fluorescent biosensors: Fusion of recombinant atpF with fluorescent proteins could generate biosensors for monitoring ATP synthase assembly, localization, and activity in live A. muciniphila cells under various conditions, providing real-time insights into energy metabolism.

  • Generation of strain-specific antibodies: Purified recombinant atpF could be used to develop highly specific antibodies for tracking A. muciniphila colonization in complex microbial communities and host tissues, advancing microbiome research techniques.

  • Development of adjuvant-free vaccines: Research suggests A. muciniphila proteins can activate immune pathways including TLR2 . Recombinant atpF could potentially be explored as a carrier protein for vaccine development, potentially enhancing immune responses.

  • Creation of synthetic microbial communities: Engineered A. muciniphila strains with modified atpF variants could be designed to establish defined interactions with other gut microbes, creating controllable synthetic communities for studying ecological dynamics relevant to human health.

  • Production of stable membrane protein nanodiscs: Recombinant atpF could be incorporated into nanodiscs or similar membrane mimetics, providing stable platforms for studying A. muciniphila membrane protein interactions and functions in vitro.

These applications would build upon existing knowledge of A. muciniphila's therapeutic potential while creating new tools to advance fundamental understanding of this important gut symbiont.

How might CRISPR-Cas9 gene editing be applied to study atpF function in A. muciniphila?

CRISPR-Cas9 gene editing offers several promising approaches for investigating atpF function in A. muciniphila:

  • Generation of conditional knockdown strains: Creating an inducible CRISPR interference (CRISPRi) system targeting atpF would allow controlled reduction of gene expression, enabling study of partial loss-of-function phenotypes without completely compromising bacterial viability.

  • Introduction of point mutations: Precise editing of specific nucleotides within the atpF gene could create variants with altered protein function, providing insights into structure-function relationships of the ATP synthase b subunit.

  • Domain swapping experiments: CRISPR-mediated homologous recombination could be used to replace portions of the atpF gene with sequences from other bacterial species, creating chimeric proteins to study domain-specific functions and evolutionary adaptations.

  • Promoter modification: Altering the native atpF promoter could create strains with constitutive or environmentally responsive expression patterns, allowing investigation of how expression levels affect ATP synthase assembly and function.

  • Tagged protein generation: Introduction of epitope tags or fluorescent protein fusions at the genomic locus would enable tracking of native atpF expression, localization, and interaction partners.

  • Simultaneous editing of multiple ATP synthase components: Multiplexed CRISPR targeting could generate strains with modifications in atpF along with other ATP synthase genes, revealing functional interactions between subunits.

Practical implementation would require optimization of transformation protocols for A. muciniphila and careful selection of guide RNAs to ensure specificity, particularly important given that ATP synthase is essential for bacterial viability.

What computational approaches could improve our understanding of atpF structure and function in A. muciniphila?

Advanced computational approaches offer powerful tools for elucidating atpF structure and function in A. muciniphila:

These computational approaches would provide valuable insights into atpF biology while guiding experimental design, ultimately accelerating research on this important component of A. muciniphila physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.