Recombinant Akodon andinus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Akodon andinus Cytochrome b (MT-CYB)

Cytochrome b, encoded by the MT-CYB gene, is a core subunit of mitochondrial Complex III (ubiquinol-cytochrome c reductase). Recombinant versions, such as Akodon andinus Cytochrome b, are produced in Escherichia coli (E. coli) systems for studies on oxidative phosphorylation, disease mechanisms, and protein interactions .

Production and Purification

The protein is expressed in E. coli and purified using affinity chromatography. Key steps include:

  • Expression: Codon-optimized MT-CYB gene cloned into E. coli vectors .

  • Purification: His-tag affinity columns yield >90% purity (verified by SDS-PAGE) .

  • Storage: Lyophilized powder stable for 12 months at -80°C; reconstituted in Tris/PBS buffer with 6% trehalose .

Biochemical and Functional Insights

  • Role in Electron Transport: Facilitates electron transfer from ubiquinol to cytochrome c, driving ATP synthesis .

  • Pathogenic Mutations: Variants like M4T (m.14757T>C) disrupt Complex III activity, linked to dilated cardiomyopathy .

  • Disease Models: Used to study mitochondrial disorders (e.g., Complex III deficiency) and metabolic syndromes .

Table 3: Clinically Relevant MT-CYB Mutations

MutationConsequenceAssociated DiseaseFrequency in Controls
M4TMethionine → ThreonineDilated Cardiomyopathy 0/100 controls
G251DGlycine → AspartateHistiocytoid Cardiomyopathy Not reported

Research Applications

  • Enzyme Activity Assays: Measures Complex III function in mitochondrial isolates .

  • Structural Studies: X-ray crystallography and cryo-EM to map electron transport mechanisms .

  • Therapeutic Development: Screens for drugs targeting mitochondrial disorders .

Limitations and Future Directions

  • Tissue-Specific Effects: Mutations show higher prevalence in skeletal muscle, complicating systemic studies .

  • Need for In Vivo Models: Transgenic animal studies are required to validate pathogenicity of novel variants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Target Names
Target Protein Sequence
MTIMRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQILTGLFLAMHYTSDTA TAFSSVTHICRDVNYGWLIRYLHANGASMFFICMFIHVGRGIYYGSYMLSETWNIGIILL LTTMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTSLVEWIWGGFSVDKATLTRFFA FHFILPFIITAFVLVHLLFLHETGSNNPSGLNSNSDKIPFHPYYTIKDLLGVIFLLMVLM ILVLFFPDVLGDPDNYTPANPLNTPAH
Uniprot No.

Q&A

What is the mitochondrial cytochrome b gene and why is it significant in Akodon research?

The mitochondrial cytochrome b (MT-CYB) gene encodes a critical protein for electron transport in cellular respiration. In Akodon research, this gene serves as a reliable molecular marker for phylogenetic analyses due to its appropriate rate of evolution and sequence conservation. The complete MT-CYB sequence consists of approximately 1,140 base pairs, making it suitable for resolving relationships among closely related species and populations .

MT-CYB has been instrumental in clarifying taxonomic relationships within the genus Akodon, particularly in cases where morphological differences are subtle. For example, maximum-parsimony, maximum-likelihood, and Bayesian analyses of cytochrome b sequences have successfully distinguished cryptic species and established phylogenetic relationships among various Akodon species in South America .

How does MT-CYB sequence variation correlate with chromosomal diversity in Akodon species?

Akodon species exhibit remarkable chromosomal variability that correlates with MT-CYB sequence divergence patterns. The genus displays a wide range of diploid numbers (2n) from as low as 10 to as high as 44, with fundamental numbers (FNa) ranging from 14 to 48 . This chromosomal polymorphism often results from Robertsonian (Rb) translocations, where chromosome arms fuse or split without losing genetic material.

When comparing cytochrome b phylogenies with karyotypic data:

Species GroupDiploid Number (2n) RangeFNa RangeMT-CYB Characteristics
A. aerosus group22-4040 (predominant)Distinct clade
A. boliviensis groupMostly 40 (A. caenosus: 34)40-42Forms monophyletic group
A. cursor group10-4414-44Most variable, includes A. diauarum with most reduced complement
A. dolores group34-4442-48Polymorphic due to Rb rearrangements
A. varius groupVariable42Limited data available

These patterns suggest that chromosomal rearrangements have played a significant role in the speciation processes within Akodon, complementing the molecular divergence observed in cytochrome b sequences .

What are the recommended protocols for isolating and amplifying MT-CYB from Akodon tissue samples?

For optimal isolation and amplification of MT-CYB from Akodon tissue samples, researchers should consider the following methodological approach:

  • DNA Extraction: Commercial kits such as QIAamp DNA Mini Kit have demonstrated reliable results for mitochondrial DNA isolation from tissue samples . For degraded or museum specimens, modified extraction protocols with extended digestion times may improve yield.

  • Mitochondrial DNA Enrichment: When working with limited tissue samples, the REPLI-g Mitochondrial DNA Kit can be employed to preferentially amplify mitochondrial DNA over nuclear DNA .

  • PCR Amplification: For complete cytochrome b gene (1,140 bp) amplification, universal mammalian primers can be used, with optimization of annealing temperatures specific to Akodon species. Typically, multiple overlapping fragments are amplified to ensure complete coverage.

  • Sequencing: Sanger sequencing has been the gold standard for MT-CYB analysis in phylogenetic studies of Akodon . For population-level studies, next-generation sequencing approaches may be more efficient when analyzing multiple specimens.

  • Quality Control: Multiple sequence amplification and bidirectional sequencing are recommended to verify accuracy, particularly when dealing with critical taxonomic determinations or novel species descriptions.

These methodologies have successfully generated reliable cytochrome b sequences for phylogenetic analyses that have resolved species boundaries and evolutionary relationships among Akodon species throughout South America .

How can researchers effectively differentiate between sequence polymorphisms and sequencing artifacts in MT-CYB analysis?

Distinguishing genuine genetic polymorphisms from technical artifacts is crucial for accurate MT-CYB analysis. Researchers should implement the following verification protocols:

  • Bidirectional Sequencing: Always sequence both DNA strands and compare for consistency. Discrepancies between forward and reverse reads at specific positions warrant further investigation.

  • Multiple Independent Amplifications: Perform replicate PCR and sequencing from the same sample to confirm consistent polymorphic sites.

  • Phylogenetic Signal Assessment: True polymorphisms typically show phylogenetic patterns consistent with other genetic markers, while random artifacts do not.

  • Population-Level Verification: Confirm suspected polymorphisms across multiple individuals from the same population. Studies have documented both synonymous variants (e.g., rs527236194, rs28357373, rs28357369, rs41504845, and rs2854124) and non-synonymous variants in MT-CYB, with specific SNPs showing significant associations with phenotypic traits .

  • Comparative Analysis: Compare sequences with published Akodon MT-CYB sequences to identify known polymorphic sites versus potential novel mutations or artifacts.

By implementing these verification methods, researchers can confidently identify true polymorphic sites that reflect evolutionary history rather than technical errors in the sequencing process.

How is MT-CYB sequence data used to resolve species relationships and identify cryptic diversity within the Akodon genus?

MT-CYB sequence data has become fundamental in resolving taxonomic uncertainties and revealing cryptic diversity within Akodon. Researchers apply several analytical approaches:

  • Phylogenetic Tree Construction: Maximum-parsimony, maximum-likelihood, and Bayesian inference analyses of complete cytochrome b sequences (1,140 bp) have successfully differentiated closely related species. For example, these methods revealed that a previously unrecognized Akodon species from the Córdoba Montane Savanna Ecoregion was sister to a clade composed of A. spegazzinii, A. boliviensis, and A. oenos .

  • Genetic Distance Calculations: Uncorrected and corrected genetic distances between MT-CYB sequences help establish thresholds for species delimitation. Within Akodon, interspecific divergences typically exceed 5-8% when comparing complete cytochrome b sequences.

  • Character-Based Diagnostics: Identifying fixed nucleotide differences that consistently separate populations supports species recognition. This approach has been particularly valuable in areas with high endemism, such as the campos de altitude of southeastern Brazil .

  • Integration with Morphological Data: MT-CYB phylogenies are most powerful when corroborated with detailed morphological analyses of external features, cranial morphology, and dental characteristics .

The combination of these approaches has led to the description of new Akodon species and the recognition of significant genetic structure within widespread taxa, demonstrating the utility of cytochrome b in revealing previously undetected biodiversity.

What are the limitations of using MT-CYB as the sole marker for Akodon phylogenetics, and how can these be addressed?

While MT-CYB has proven invaluable in Akodon systematics, researchers should be aware of several limitations when using it as the sole phylogenetic marker:

  • Maternal Inheritance: As mitochondrial DNA is maternally inherited, MT-CYB alone cannot detect hybridization, introgression, or incomplete lineage sorting that may affect nuclear genes. This is particularly relevant in Akodon, where chromosomal rearrangements and potential hybridization zones have been documented .

  • Saturation at Deep Divergences: MT-CYB may exhibit substitution saturation when examining relationships among deeply divergent lineages, potentially obscuring ancient evolutionary relationships.

  • Rate Heterogeneity: Variation in evolutionary rates among lineages can affect phylogenetic inference, particularly when comparing distantly related groups.

  • Mitochondrial Pseudogenes: Nuclear insertions of mitochondrial fragments (NUMTs) can confound analyses if inadvertently amplified instead of the authentic mitochondrial gene.

To address these limitations, researchers should:

  • Implement Multi-Locus Approaches: Combine MT-CYB with nuclear markers to provide a more comprehensive evolutionary perspective.

  • Integrate Cytogenetic Data: Chromosomal analyses, including diploid number, fundamental number, and banding patterns, provide independent evidence of evolutionary relationships .

  • Apply Appropriate Analytical Methods: Use models that account for rate heterogeneity and implement partitioned analyses that consider codon position effects.

  • Verify Mitochondrial Origin: Design primers specific to authentic MT-CYB and verify sequences through comparison with known mitochondrial sequences.

By acknowledging these limitations and implementing complementary approaches, researchers can develop robust phylogenetic hypotheses that accurately reflect evolutionary relationships within Akodon.

What types of polymorphisms have been documented in MT-CYB across Akodon species, and what are their functional implications?

Studies of MT-CYB across Akodon species have revealed diverse polymorphism types with potential functional consequences:

  • Synonymous Variants: Several synonymous polymorphisms have been documented in MT-CYB, including rs527236194, rs28357373, rs28357369, rs41504845, and rs2854124 . Though these variants do not alter amino acid sequences, they may affect translation efficiency, mRNA stability, or splicing regulation.

  • Non-Synonymous Variants: Multiple missense variants have been identified, including rs2853508, rs28357685, rs41518645, rs2853507, rs28357376, rs35070048, rs2853506, and rs28660155 . These substitutions result in amino acid changes that could potentially affect protein structure and function.

  • Population-Specific Variants: Certain MT-CYB variants show differential distribution among populations and may correlate with ecological adaptations or geographical isolation patterns.

Functional implications of these polymorphisms include:

  • Mitochondrial Efficiency: Non-synonymous mutations may affect electron transport chain efficiency, potentially influencing metabolic performance and adaptation to different altitudinal or climatic conditions.

  • Reproductive Biology: Some MT-CYB variants have shown significant association with reproductive traits. For instance, variants rs527236194 (P = 0.0005), rs28357373 (P = 0.0439), and rs41504845 (P = 0.0038) demonstrated statistically significant associations with fertility parameters .

  • Speciation Mechanisms: Accumulation of mutations in MT-CYB may contribute to reproductive isolation and speciation processes in the Akodon genus, particularly when combined with chromosomal rearrangements.

These findings suggest that MT-CYB variation may play important roles beyond serving as a neutral marker for phylogenetic studies, potentially contributing to adaptive processes and reproductive isolation mechanisms.

How do selection pressures affect MT-CYB evolution in high-altitude Akodon populations?

High-altitude environments impose unique selective pressures on mitochondrial genes, including MT-CYB, due to reduced oxygen availability and often extreme temperature fluctuations. For Akodon species inhabiting elevated regions, such as A. andinus and other high-altitude specialists, several patterns emerge:

  • Altitudinal Adaptation Signatures: Comparison of MT-CYB sequences between lowland and highland Akodon populations may reveal amino acid substitutions that affect protein function in ways that optimize electron transport under hypoxic conditions.

  • Purifying vs. Positive Selection: Analysis of non-synonymous to synonymous substitution ratios (dN/dS) across MT-CYB codons can identify regions under different selection regimes. Functionally critical regions typically show strong purifying selection, while sites experiencing positive selection may indicate adaptive changes.

  • Convergent Evolution: Similar MT-CYB mutations may evolve independently in Akodon populations from different mountain systems as parallel adaptations to high-altitude conditions, particularly in the campos de altitude of southeastern Brazil and the Andean highlands .

  • Coevolution with Nuclear Genes: Selection on MT-CYB likely occurs in concert with selection on nuclear-encoded mitochondrial proteins, maintaining coadaptation between mitochondrial and nuclear genomes.

To assess these patterns, researchers should consider:

  • Comparative analysis of complete MT-CYB sequences across altitudinal gradients

  • Site-specific selection tests focused on functional domains of the cytochrome b protein

  • Integration of physiological data with genetic variation patterns

  • Experimental validation of functional effects of altitude-associated mutations

Understanding the selective forces acting on MT-CYB in high-altitude Akodon populations provides insights into molecular mechanisms of adaptation to challenging environments and the role of mitochondrial variation in speciation processes.

How can recombinant expression systems for Akodon MT-CYB be optimized to study protein structure-function relationships?

Optimizing recombinant expression of Akodon MT-CYB presents unique challenges due to its hydrophobic nature and mitochondrial membrane localization. Researchers should consider the following approaches:

  • Expression System Selection:

    • Prokaryotic systems (E. coli): Suitable for producing peptide fragments for antibody generation or structural studies

    • Eukaryotic systems (yeast, insect cells): Better for full-length functional protein due to appropriate membrane structures and post-translational modification machinery

  • Construct Design Considerations:

    • Codon optimization based on host expression system

    • Addition of solubility tags (MBP, SUMO, or GST) to improve folding

    • Inclusion of purification tags positioned to minimize interference with functional domains

    • Potential modification of highly hydrophobic transmembrane regions

  • Purification Strategy:

    • Detergent selection compatible with maintenance of protein structure and function

    • Two-step purification protocols to enhance purity while preserving native conformation

    • Reconstitution into liposomes or nanodiscs for functional studies

  • Validation Methods:

    • Spectroscopic analysis to confirm proper heme incorporation and folding

    • Activity assays measuring electron transfer capabilities

    • Structural characterization through circular dichroism or X-ray crystallography when feasible

  • Site-Directed Mutagenesis Applications:

    • Introduction of species-specific or altitude-specific amino acid substitutions

    • Creation of chimeric proteins combining domains from different Akodon species

    • Systematic mutation of conserved vs. variable residues to map functional domains

These approaches enable detailed investigation of how sequence polymorphisms identified in MT-CYB across Akodon species relate to protein function, particularly those possibly associated with adaptation to different ecological niches or altitudinal gradients.

What are the biogeographical implications of MT-CYB phylogenetic patterns in Akodon species across South American mountain systems?

The phylogenetic patterns revealed by MT-CYB analyses of Akodon species provide valuable insights into the biogeographical history of South American mountain systems:

  • Vicariance vs. Dispersal: MT-CYB divergence patterns help determine whether current distribution of Akodon species resulted from vicariance (fragmentation of once continuous populations) or dispersal events across geographical barriers. The distinctive MT-CYB lineages found in isolated mountain ranges, such as the Sierras Centrales in central Argentina and the campos de altitude in southeastern Brazil, suggest long periods of isolation following past dispersal events .

  • Historical Connectivity: Phylogenetic relationships among Akodon from different mountain systems illuminate historical connections between currently isolated habitats. For example, MT-CYB data can reveal whether the campos de altitude of southeastern Brazil were historically connected with other South American biomes through corridors that allowed faunal exchange .

  • Endemism Patterns: The discovery of endemic Akodon species with distinctive MT-CYB sequences in isolated mountain ranges supports the "sky island" biogeographic model, where high-elevation habitats function as archipelagos of isolated evolutionary laboratories. This has particular relevance for conservation planning for mountaintop specialists with restricted distributions .

  • Divergence Timing: Molecular clock analyses of MT-CYB sequences can estimate divergence times among Akodon lineages, correlating speciation events with known geological events such as Andean uplift phases or Pleistocene climatic oscillations.

  • Diversification Rates: Comparative analysis of MT-CYB phylogenies across different mountain systems can reveal whether diversification rates within Akodon varied among regions, potentially reflecting differences in ecological opportunity or isolation intensity.

These biogeographical patterns derived from MT-CYB phylogenies are crucial for understanding the evolutionary history of South American montane biotas and can inform conservation strategies for these unique and often threatened ecosystems.

How can MT-CYB data be integrated with chromosomal analysis to better understand speciation mechanisms in the Akodon genus?

The integration of MT-CYB sequence data with chromosomal analysis provides a powerful approach to understanding speciation mechanisms in Akodon:

  • Correlation of Molecular and Chromosomal Divergence: Comparing MT-CYB sequence divergence with karyotypic differences helps assess whether chromosomal rearrangements preceded, coincided with, or followed molecular divergence. In Akodon, the relationship between MT-CYB lineages and chromosomal polymorphisms, particularly Robertsonian (Rb) translocations, provides insights into the relative contributions of different mechanisms to reproductive isolation .

  • Detection of Hybridization and Introgression: Discordance between MT-CYB phylogenies and chromosomal patterns may indicate historical hybridization events. For example, in the A. dolores species complex, specimens with intermediate karyotypes (2n=43) but distinctive MT-CYB haplotypes could represent hybrid zones or ongoing gene flow despite chromosomal differences .

  • Methodological Integration:

    Analysis TypeMethodologyInformation Provided
    ChromosomalG-banding, C-banding, FISH with telomeric probesStructural rearrangements, heterochromatin distribution
    MT-CYBComplete gene sequencing (1,140 bp)Phylogenetic relationships, divergence timing
    CombinedStatistical correlation of genetic vs. chromosomal distancesMechanisms of speciation
  • Case Studies: The A. dolores species complex demonstrates the value of integrated analysis, as chromosomal polymorphisms (2n=42-44) resulting from Rb translocations correspond to specific distribution patterns and subtle molecular divergence . Similarly, the synonymy of A. molinae (2n=34-40) with A. dolores is supported by both MT-CYB similarity and the demonstration that all chromosomal complements have exact arm correspondences, with differences principally due to Rb rearrangements .

  • Speciation Models Assessment: The combined data allows evaluation of different speciation models in Akodon:

    • Chromosomal speciation through underdominance of heterozygotes

    • Suppressed recombination models where rearrangements reduce gene flow

    • Reinforcement of reproductive barriers following secondary contact

By integrating MT-CYB and chromosomal analyses, researchers can develop comprehensive models of speciation processes in Akodon that account for both molecular evolution and chromosomal rearrangements, providing insights applicable to mammalian evolution more broadly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.