Recombinant Akodon olivaceus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Akodon olivaceus Cytochrome b

Recombinant Akodon olivaceus Cytochrome b (MT-CYB) is a mitochondrially encoded protein derived from Akodon olivaceus, commonly known as the South American field mouse or Olive grass mouse . The protein is produced through recombinant DNA technology, typically expressed in bacterial systems such as E. coli, to provide a reliable source for research applications . Cytochrome b represents one of the most widely utilized molecular markers in evolutionary studies of mammals, particularly for species identification and phylogenetic analyses .

The mitochondrial cytochrome b gene (MT-CYB) encodes a protein that serves as a key component of the respiratory electron transport chain, specifically as part of Complex III (ubiquinol-cytochrome c reductase complex) . This protein has gained significant attention in biological research due to its highly conserved functional domains alongside variable regions that make it particularly valuable for discriminating between closely related species .

Biological Function and Significance

Cytochrome b serves as an essential component of the mitochondrial respiratory chain, specifically within Complex III (ubiquinol-cytochrome c reductase complex) . The protein plays a crucial role in electron transport coupled proton transport, facilitating the transfer of electrons from ubiquinol to cytochrome c . This process contributes significantly to the generation of a proton gradient across the mitochondrial membrane that is subsequently utilized for ATP synthesis, making cytochrome b essential for cellular energy production .

The conserved nature of functional domains in cytochrome b, combined with species-specific variations in certain regions, makes this protein particularly valuable for evolutionary biology studies. The MT-CYB gene has become a benchmark molecular marker for phylogenetic analyses, especially in studies of mammalian systematics including the genus Akodon .

Applications in Evolutionary Biology and Taxonomy

The mitochondrial cytochrome b gene has proven invaluable for resolving taxonomic relationships among South American rodents, particularly within the genus Akodon . Studies utilizing cytochrome b sequence data have revealed important insights into the evolutionary history and species boundaries within this diverse rodent group.

Species Identification and Discrimination

MT-CYB sequences, even short fragments, have demonstrated remarkable utility for species identification in both fresh and degraded biological samples . Research has shown that a fragment as small as 127 bp of the cytochrome b gene can provide sufficient variation for reliable species discrimination, with interspecies genetic diversity ranging from 8.36% to 42.52% . This makes recombinant cytochrome b proteins and their corresponding genes valuable tools for forensic applications and biodiversity studies.

Phylogenetic Relationships in Akodon Species

Studies of cytochrome b sequence variation have been instrumental in clarifying relationships among Akodon species. Genetic analysis of A. olivaceus and A. xanthorhinus, for example, revealed substantial genetic similarity between these formerly distinct species, leading researchers to conclude that they should be united under the species name olivaceus . This demonstrates the power of cytochrome b as a molecular marker for resolving taxonomic uncertainties.

Research investigating sequence divergence within and between Akodon species has shown that:

  • Two individuals from the same local population typically differ by less than 1% sequence divergence

  • Geographic samples within a species show 0.25%-8% sequence divergence

  • Different species exhibit 3%-21% sequence divergence

  • Comparisons between akodontine sequences and the house mouse reveal 21%-25% sequence difference

Table 2: Genetic Divergence Based on Cytochrome b Sequences in Akodon and Related Species

Comparison LevelSequence Divergence
Within local population<1%
Geographic samples within species0.25-8%
Between species3-21%
Between akodontine and house mouse21-25%

Comparative Analysis with Other Akodon Species

The genus Akodon comprises numerous species distributed throughout South America, with several species groups recognized based on molecular phylogenetic analyses . Cytochrome b sequence data has been instrumental in resolving relationships among these groups.

Research utilizing cytochrome b and other genetic markers has supported the monophyly of certain Akodon species groups, including the boliviensis and cursor groups . These studies have also helped clarify the taxonomic status of various Akodon species, including the relationship between A. olivaceus and A. xanthorhinus.

An interesting phenomenon observed in some Akodon species is the presence of fertile XY females, which creates a unique pattern of mitochondrial DNA inheritance . In species like A. boliviensis and A. azarae, which contain 35% and 10% XY females respectively, the transmission of mitochondrial haplotypes follows a distinctive pattern that can be tracked through cytochrome b sequence analysis .

Applications in Molecular Biology

Recombinant cytochrome b from A. olivaceus can be utilized in various molecular biology applications:

  1. As a positive control or standard in PCR-based species identification

  2. In immunological assays including ELISA and Western blotting

  3. For generating antibodies against conserved regions of mammalian cytochrome b

  4. As a reference for comparative sequence analysis in phylogenetic studies

  5. For structure-function relationship studies of mitochondrial proteins

Future Research Directions

The continuing development of databases like the Amphibia's Curated Database of Cytochrome-b (ACDC) demonstrates the ongoing importance of cytochrome b sequences in evolutionary biology research . While this particular database focuses on amphibians, similar curation efforts for mammalian cytochrome b sequences would be valuable for enhancing the reliability of research utilizing these markers.

Future research directions may include:

  1. Development of comprehensive databases of mammalian cytochrome b sequences with improved curation protocols

  2. Utilization of recombinant cytochrome b proteins in structural biology studies to better understand species-specific variations

  3. Integration of cytochrome b sequence data with other molecular markers for more robust phylogenetic analyses

  4. Application of cytochrome b-based identification methods in conservation biology and biodiversity monitoring

  5. Investigation of the functional consequences of species-specific variations in cytochrome b structure

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Abrothrix olivaceus (Olive grass mouse) (Akodon olivaceus)
Target Names
Target Protein Sequence
MTIMRKNHPLLKIINHSFIDLPTPSNISSWWNFGSLLGICLMIQILTGLFLAMHYTSDTA TAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFIHVGRGIYYGSYMLSETWNIGIILF LTTMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTSLVEWIWGGFSVDKATLTRFFA FHFILPFIITAFVLVHLLFLHETGSNNPSGLNSNSDKIPFHPYYTIKDLLGVILLLMVLM ILVLFFPDVLGDPDNYTPANPLNTPAH
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that forms part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Akodon olivaceus Cytochrome b and why is it significant in evolutionary research?

Akodon olivaceus cytochrome b (MT-CYB) is a mitochondrial gene encoding a protein involved in the electron transport chain and oxidative phosphorylation. It has become significant in evolutionary research because it provides valuable insights into phylogenetic relationships and adaptive evolution, particularly in rodent species. The gene is approximately 1140 bp in length and has been extensively used to study diversification in the Akodon olivaceus/xanthorhinus complex found in Chile and Argentina . Studies have shown that the level of variation in the cytochrome b sequence throughout this complex is comparable to that seen within a single species in many South American sigmodontine rodents, supporting the classification of both taxa as sub-species of A. olivaceus . This gene serves as an excellent marker for studying recent evolutionary events due to its appropriate mutation rate and conservation across species.

How are recombinant Cytochrome b proteins typically expressed and purified for research applications?

Recombinant Cytochrome b proteins, including those from Akodon olivaceus, are typically expressed in several host systems:

  • Bacterial expression (E. coli): Most commonly used due to high protein yields and simplified purification

  • Yeast expression systems: Used when post-translational modifications are important

  • Baculovirus expression: Employed for complex proteins requiring specific folding

  • Mammalian cell systems: Used when authentic mammalian post-translational modifications are critical

The purification process typically involves:

  • Cell lysis under conditions that maintain protein structure

  • Initial capture using affinity chromatography (often utilizing histidine tags)

  • Further purification via ion exchange or size exclusion chromatography

  • Quality control assessment including SDS-PAGE to achieve ≥85% purity

Recombinant cytochrome b proteins are generally tagged with affinity markers to facilitate isolation from the expression host while maintaining functional integrity. The purification approach must balance protein yield with functional activity, as cytochrome b's membrane-associated nature can present challenges for solubility and proper folding.

What sequence characteristics should researchers verify when working with recombinant Akodon olivaceus MT-CYB?

When working with recombinant Akodon olivaceus MT-CYB, researchers should verify:

  • Complete coding sequence integrity: Confirm the approximately 1140 bp complete cytochrome b gene sequence matches reference sequences (GenBank accession numbers AF297882 and related sequences)

  • Key conserved domains: Verify the presence of critical functional domains including:

    • Transmembrane regions

    • Quinone binding sites

    • Heme binding sites

  • Species-specific variation: Examine characteristic polymorphic sites that distinguish A. olivaceus from related species, particularly A. xanthorhinus, with which it forms a complex

  • Expression construct accuracy: Ensure no frameshift mutations or premature stop codons exist in the recombinant construct

  • Post-translational modification sites: Verify conservation of sites required for proper protein folding and function

Additionally, researchers should assess codon optimization for the chosen expression system, as suboptimal codon usage can significantly impact recombinant protein expression levels and functionality.

What PCR and sequencing protocols are most effective for amplifying and analyzing Akodon olivaceus cytochrome b?

The most effective protocols for amplifying and sequencing Akodon olivaceus cytochrome b incorporate:

PCR Amplification Approach:

  • Primer design: Universal mammalian cytochrome b primers with modifications for Akodon-specific regions are most effective

  • DNA template quality: Fresh tissue or well-preserved specimens yield the best results, with liver or muscle tissue preferred

  • PCR conditions: Initial denaturation at 94°C (3-5 min), followed by 30-35 cycles of denaturation (94°C, 30s), annealing (48-52°C, 45s), and extension (72°C, 1-1.5 min), with a final extension (72°C, 10 min)

Sequencing Protocol:

  • Full gene coverage: Sequencing the entire cyt b gene (approximately 1140 bp) as performed in previous studies of A. olivaceus

  • Bidirectional sequencing: Using both forward and reverse primers to ensure sequence accuracy

  • Multiple individuals: Analyzing multiple specimens (≥20 individuals) from different populations to capture genetic variation

Quality Control Measures:

  • Chromatogram inspection for base-calling accuracy

  • Comparison to reference sequences

  • Translation to amino acid sequence to check for premature stop codons or frameshift mutations

These methods have proven effective in previous studies examining the A. olivaceus/xanthorhinus complex, providing sufficient resolution to detect population-level genetic variation and phylogenetic relationships .

How should researchers analyze cytochrome b sequence data to distinguish between patterns of selection and genetic drift?

To distinguish between patterns of selection and genetic drift in cytochrome b sequences, researchers should implement a multi-faceted analytical approach:

Statistical Tests of Selection:

  • dN/dS ratio (ω) calculation: Measure the ratio of nonsynonymous to synonymous substitution rates. In subterranean rodent species, cytochrome b showed increased ω values and evidence of relaxed selection compared to non-subterranean lineages

  • Site-specific selection analysis: Utilize maximum likelihood methods (PAML, HyPhy) to identify specific codons under positive or negative selection

Neutrality Tests:

  • Tajima's D test: Significant negative values may indicate recent population expansion or purifying selection

  • Fu and Li's F and D statistics: Help distinguish between selection and demographic effects

  • McDonald-Kreitman test: Compare fixed differences to polymorphisms at synonymous and nonsynonymous sites

Distribution Pattern Analysis:

  • Mismatch distribution analysis: Distinct patterns emerge depending on whether taxa diverged in allopatric refuges or through selection across ecological gradients

  • Haplotype network construction: Reveals relationships between haplotypes that can indicate selection or drift

Functional Domain Analysis:

  • Evaluate if nonsynonymous substitutions cluster in specific protein domains

  • Research has shown that eight protein domains in cytochrome b possess increased nonsynonymous substitution ratios in some subterranean species, indicating potential adaptive significance

The effective combination of these approaches allows researchers to differentiate between neutral processes and selective pressures acting on cytochrome b sequences.

What are the optimal protein expression conditions for producing functional recombinant Akodon olivaceus Cytochrome b?

Producing functional recombinant Akodon olivaceus Cytochrome b requires carefully optimized expression conditions:

Expression System Selection:

  • E. coli systems: Most commonly used for initial expression testing

  • Yeast systems: Provide better membrane protein folding for hydrophobic proteins like cytochrome b

  • Baculovirus systems: Offer superior post-translational modifications for complex proteins

Critical Expression Parameters:

  • Temperature: Lower temperatures (16-25°C) generally improve proper folding of membrane proteins

  • Induction conditions: Gentle induction with lower concentrations of inducers (0.1-0.5mM IPTG for E. coli)

  • Expression duration: Extended expression periods (24-72 hours) at reduced temperatures

  • Media supplements: Addition of heme precursors and iron supplements to support proper cofactor incorporation

Solubilization Strategy:

  • Detergent selection: Mild non-ionic detergents (DDM, LDAO) for membrane protein extraction

  • Buffer optimization: Including glycerol (10-15%) to stabilize protein structure

  • pH optimization: Testing narrow pH ranges (typically pH 7.0-8.0) for optimal stability

Purification Approach:

  • Initial capture via affinity chromatography (His-tag or other fusion tags)

  • Secondary purification using ion exchange or size exclusion chromatography

  • Quality verification by SDS-PAGE with minimum purity threshold of 85%

Functional Verification:

  • Spectroscopic analysis to confirm heme incorporation

  • Reduction-oxidation assays to verify electron transfer capability

  • Structural integrity assessment via circular dichroism spectroscopy

The optimization of these conditions is critical for obtaining properly folded, functional recombinant cytochrome b protein suitable for downstream applications.

How can researchers use cytochrome b sequence data to resolve phylogenetic relationships in closely related species like the Akodon olivaceus/xanthorhinus complex?

Resolving phylogenetic relationships in closely related species using cytochrome b requires sophisticated methodological approaches:

Sampling Strategy:

  • Comprehensive geographic sampling: Include specimens from across the entire geographic range, with particular focus on potential contact zones and ecological transitions

  • Multiple individuals per population: Sample multiple individuals (ideally 5+) from each population to capture intra-population variation

  • Integration of ecological data: Record habitat type, elevation, and other ecological parameters to correlate with genetic patterns

Analytical Approaches:

  • Network-based methods: Haplotype networks provide better resolution than tree-based methods for recently diverged lineages

  • Bayesian phylogenetic inference: Implement coalescent-based species tree methods that accommodate incomplete lineage sorting

  • Divergence time estimation: Calibrate molecular clock analyses with appropriate fossil or biogeographic calibration points

Data Interpretation Framework:

  • Model testing: The Akodon olivaceus/xanthorhinus complex demonstrates both allopatric divergence in Pleistocene refuges and postglacial diversification across ecological gradients

  • Mismatch distribution analysis: This method revealed contrasting patterns depending on whether taxa diverged in allopatric refuges or through selection across gradients

  • Evaluation of reciprocal monophyly: Haplotypes of A. xanthorhinus have not yet achieved reciprocal monophyly relative to those of A. olivaceus, suggesting recent divergence

Researchers should integrate cytochrome b data with nuclear markers and morphological traits to develop a comprehensive understanding of evolutionary relationships, particularly in cases where mitochondrial introgression may confound phylogenetic inference.

What methods can detect adaptive evolution in the cytochrome b gene across different ecological niches?

Detecting adaptive evolution in cytochrome b across ecological niches requires multiple complementary approaches:

Sequence-Based Selection Analyses:

  • Branch-site models: These can identify positive selection on specific lineages in a phylogeny

  • Relaxed selection analysis: Studies have shown cytochrome b exhibits relaxed selection in subterranean lineages compared to surface-dwelling relatives

  • Convergent evolution detection: Statistical methods can identify parallel amino acid changes in unrelated lineages adapting to similar environments

Structural Analysis Approaches:

  • Protein structure modeling: Map amino acid substitutions onto tertiary protein structures to assess potential functional impacts

  • Functional domain analysis: Eight protein domains in cytochrome b show increased nonsynonymous substitution ratios in subterranean species

  • Protein-protein interaction sites: Examine changes at sites involved in interactions with other respiratory complex components

Correlation with Ecological Parameters:

  • Environmental correlation analysis: Test associations between specific mutations and environmental variables

  • Physiological measurements: Correlate sequence variation with metabolic rates and oxygen consumption

  • Comparative analysis across multiple taxa: Identify convergent substitutions in phylogenetically distant subterranean species, as found in Arvicolinae rodents

Experimental Validation:

  • Site-directed mutagenesis: Introduce specific mutations into recombinant proteins to test functional effects

  • Enzyme kinetics assays: Measure effects of mutations on electron transfer efficiency

  • Thermostability assays: Assess protein stability under different temperature conditions

This integrated approach can reveal how cytochrome b evolution contributes to adaptation across diverse ecological niches, as demonstrated in studies of subterranean versus surface-dwelling rodent species .

How do mutations in recombinant MT-CYB affect mitochondrial respiratory chain function and potential disease models?

Mutations in recombinant MT-CYB can significantly impact respiratory chain function with implications for disease modeling:

Functional Consequences of Mutations:

  • Electron transfer disruption: Mutations in highly conserved regions can impair electron transfer between complex III components

  • Reactive oxygen species (ROS) generation: Certain mutations increase electron leakage and ROS production

  • Protein stability alterations: Some mutations affect protein folding and stability within the mitochondrial membrane

  • Assembly defects: Mutations can disrupt assembly of the full respiratory complex

Clinical Implications:

  • Mitochondrial myopathy: MT-CYB mutations have been commonly associated with isolated mitochondrial myopathy and exercise intolerance

  • Multisystem disorders: In rare cases, MT-CYB mutations can cause multisystem conditions

  • MELAS overlap syndrome: A novel mutation (m.14864 T>C) in MT-CYB was found in a patient with migraines, epilepsy, sensorimotor neuropathy, and strokelike episodes

  • Heteroplasmy effects: The mutation was heteroplasmic in muscle, blood, fibroblasts, and urinary sediment from the patient but absent in the asymptomatic mother

Research Applications:

  • Structure-function analysis: Site-directed mutagenesis of recombinant MT-CYB can identify critical residues

  • Pathogenicity assessment: In vitro studies with recombinant proteins can evaluate novel variants of uncertain significance

  • Drug screening platforms: Mutant recombinant proteins can be used to screen for compounds that might rescue function

Experimental Approaches:

  • Oxygen consumption measurements: Quantify respiratory capacity with different mutations

  • Mitochondrial membrane potential assays: Assess the impact on proton gradient formation

  • Supercomplex formation analysis: Determine how mutations affect interactions with other respiratory complexes

These studies highlight the importance of MT-CYB in mitochondrial function and disease, with recombinant protein systems providing valuable platforms for mechanistic investigation and therapeutic development.

What bioinformatic pipelines best integrate cytochrome b sequence data with other markers for comprehensive phylogenomic studies?

Comprehensive phylogenomic studies integrating cytochrome b with other markers require sophisticated bioinformatic pipelines:

Data Integration Framework:

  • Multi-gene concatenation approaches: Combine cytochrome b with other mitochondrial and nuclear markers

  • Coalescent-based methods: Account for gene tree discordance using methods like ASTRAL or StarBEAST2

  • Partition models: Apply appropriate evolutionary models to different gene regions

Marker Selection Strategy:

  • Complementary markers: Pair cytochrome b (rapid evolution) with more conserved nuclear genes

  • Resolution at different timescales: Include markers evolving at different rates for both deep and shallow divergences

  • Introgression detection: Incorporate multiple unlinked markers to identify potential mitochondrial introgression

Analytical Pipeline Components:

  • Quality control and alignment:

    • Trimmomatic/FastQC for read quality assessment

    • MAFFT/MUSCLE for alignment with refinement using GBLOCKS

    • Translation verification to detect pseudogenes

  • Phylogenetic reconstruction:

    • Maximum likelihood (RAxML/IQ-TREE)

    • Bayesian inference (MrBayes/BEAST)

    • Network approaches (SplitsTree/PopART)

  • Divergence dating and demographic analysis:

    • Calibrated molecular clock analyses

    • Mismatch distribution analysis for demographic inference

    • Bayesian skyline plots for population size changes

  • Selection and adaptation analysis:

    • PAML/HyPhy for selection tests across lineages

    • Structure mapping of variants

    • Tests for convergent evolution

Visualization and Interpretation:

  • Interactive visualization tools: Use of Figtree, ggtree, or phytools for tree visualization

  • Geographic information integration: BEAST2 with phylogeographic modules

  • Character mapping: Ancestral state reconstruction of ecological traits

This integrated approach allows researchers to leverage the phylogenetic signal from cytochrome b while addressing its limitations through complementary markers and sophisticated analytical methods.

How should researchers interpret contradictory signals between cytochrome b and nuclear markers in phylogenetic studies?

Interpreting contradictory signals between cytochrome b and nuclear markers requires systematic evaluation of potential biological and methodological explanations:

Biological Causes of Discordance:

  • Incomplete lineage sorting (ILS): Common in recent or rapid radiations, as seen in the Akodon olivaceus/xanthorhinus complex

  • Introgression and hybridization: Mitochondrial capture can occur without substantial nuclear gene flow

  • Sex-biased dispersal: Different patterns between maternally inherited mitochondrial and biparentally inherited nuclear markers

  • Selection pressures: Cytochrome b may experience different selective regimes than nuclear genes, particularly in species adapting to new environments

Analytical Approaches to Address Discordance:

  • Explicit testing of alternative hypotheses:

    • Use multispecies coalescent models that account for ILS

    • Apply isolation-with-migration models to test for gene flow

    • Implement demographic simulations to evaluate expected patterns under different scenarios

  • Quantification of discordance:

    • Calculate topology tests (AU test, SH test) to assess statistical support for different trees

    • Implement quartet-based measures of gene tree conflict

    • Visualize discordance using cloudograms or tanglegrams

  • Integrated analysis framework:

    • Use model-based approaches that simultaneously estimate species trees and gene flow

    • Implement Bayesian approaches that can incorporate different evolutionary models for different markers

    • Employ network methods rather than strictly bifurcating trees when appropriate

Interpretation Guidelines:

  • Recent diversification events (like those in the Akodon complex) commonly show discordance due to incomplete lineage sorting

  • Evaluate whether discordance patterns align with known contact zones or historical biogeographic barriers

  • Consider adaptive pressures on cytochrome b that might drive mitochondrial evolution independently from the nuclear genome

  • Weigh evidence from multiple independent nuclear loci more heavily than single-locus mitochondrial data when discordance exists

Researchers must recognize that discordance often reflects real biological processes rather than methodological artifacts, and these patterns can provide valuable insights into evolutionary history when properly analyzed.

What quality control measures are essential when working with recombinant cytochrome b proteins?

Essential quality control measures for recombinant cytochrome b proteins include:

Expression and Purification QC:

  • Purity assessment: SDS-PAGE analysis to confirm ≥85% purity, as specified in commercial recombinant protein standards

  • Western blot verification: Confirmation of protein identity using specific antibodies

  • Mass spectrometry validation: Peptide mass fingerprinting to verify sequence integrity

  • Size exclusion chromatography: Assessment of aggregation state and homogeneity

Structural Integrity Verification:

  • Spectroscopic analysis: Absorption spectra to confirm proper heme incorporation

  • Circular dichroism: Evaluation of secondary structure elements

  • Thermal stability assessment: Differential scanning fluorimetry to determine protein stability

  • Limited proteolysis: Test for proper folding and domain organization

Functional Validation:

  • Redox activity: Measurement of electron transfer capability

  • Enzyme kinetics: Determination of reaction rates and substrate affinity

  • Protein-protein interaction assays: Verification of proper complex formation with other respiratory chain components

  • Reconstitution studies: Assessment of function when incorporated into liposomes or nanodiscs

Storage Stability Testing:

  • Freeze-thaw stability: Evaluation of activity retention after multiple freeze-thaw cycles

  • Long-term storage conditions: Optimization of buffer composition, pH, and additives

  • Temperature sensitivity: Assessment of stability at different storage temperatures

Batch-to-Batch Consistency:

  • Lot comparison: Functional and structural comparison between production lots

  • Reference standard comparison: Benchmarking against validated reference materials

  • Activity normalization: Standardization protocols to ensure consistent specific activity

Implementing these quality control measures ensures that experimental results using recombinant cytochrome b are reliable and reproducible across different research applications.

How can researchers effectively use cytochrome b as a molecular clock for dating evolutionary events in rodent lineages?

Effectively using cytochrome b as a molecular clock requires careful methodological considerations:

Calibration Approaches:

  • Fossil calibration: Incorporate well-documented rodent fossils with reliable dating

  • Biogeographic events: Use dated geological events (e.g., island formation, mountain uplifts) that influenced population separation

  • Secondary calibration: Apply divergence dates from previous comprehensive phylogenetic studies

Rate Variation Considerations:

  • Lineage-specific rate heterogeneity: Account for variation in evolutionary rates across rodent lineages

  • Substitution saturation assessment: Test for saturation at third codon positions that might compromise dating accuracy

  • Codon partition models: Apply separate models to different codon positions with appropriate rate variation parameters

Dating Method Selection:

  • Relaxed clock models: Implement uncorrelated lognormal or exponential relaxed clocks in BEAST

  • Bayesian dating approaches: Utilize BEAST or MCMCTree with appropriate priors on node ages

  • Maximum likelihood dating: RelTime or treePL for larger datasets

Validation Strategies:

  • Cross-validation with nuclear genes: Compare dates obtained from cytochrome b with those from nuclear loci

  • Sensitivity analysis: Assess how different calibration schemes affect divergence estimates

  • Prior influence evaluation: Test how different prior distributions affect posterior date estimates

Application to Akodon Complex:
The cytochrome b gene has been valuable in dating recent diversification events in the Akodon olivaceus/xanthorhinus complex, revealing patterns consistent with both Pleistocene glacial cycles and postglacial ecological diversification . Analysis of mismatch distributions has provided insights into the timing of population expansions, showing contrasting patterns depending on whether populations diverged in allopatric refuges or through selection across ecological gradients .

When properly calibrated and with appropriate models accounting for rate heterogeneity, cytochrome b can provide valuable temporal context for understanding rodent diversification patterns, particularly for recent events within the last few million years.

What are the emerging applications of recombinant cytochrome b in functional studies of mitochondrial diseases?

Recombinant cytochrome b is enabling significant advances in mitochondrial disease research:

Mutation Analysis Platforms:

  • Pathogenic variant characterization: Recombinant systems allow systematic testing of novel mutations like the m.14864 T>C mutation found in a patient with MELAS-like symptoms

  • Structure-function correlations: Mapping mutations onto protein structure to predict functional consequences

  • High-throughput variant screening: Developing systems to rapidly assess multiple variants of uncertain significance

Disease Mechanism Investigation:

  • Electron transport chain dysfunction: Quantitative assessment of how specific mutations disrupt electron flow

  • ROS generation: Measurement of how mutations affect reactive oxygen species production

  • Energy production efficiency: Assessment of ATP synthesis capacity with variant cytochrome b proteins

Therapeutic Development Applications:

  • Drug screening platforms: Using recombinant systems to identify compounds that might rescue mutant function

  • Gene therapy target validation: Testing potential gene therapy approaches in recombinant systems

  • Allotopic expression modeling: Evaluating nuclear-encoded versions of cytochrome b for therapeutic potential

Advanced Research Techniques:

  • CRISPR-based mitochondrial editing: Validation of edited sequences using recombinant protein expression

  • Single-molecule studies: Investigation of electron transfer dynamics in wild-type versus mutant proteins

  • Cryo-EM structural studies: Using recombinant proteins to determine high-resolution structures of variant proteins

Emerging Clinical Applications:

  • Personalized medicine approaches: Testing patient-specific mutations to guide treatment strategies

  • Biomarker development: Identifying metabolic signatures associated with specific cytochrome b variants

  • Heteroplasmy modeling: Using mixtures of wild-type and mutant recombinant proteins to mimic heteroplasmic states seen in patients

These emerging applications demonstrate how recombinant cytochrome b is becoming an essential tool for advancing our understanding of mitochondrial diseases and developing potential therapeutic interventions.

How might future studies leverage cytochrome b sequences to understand climate adaptation in rodent species?

Future studies can leverage cytochrome b sequences to understand climate adaptation through innovative approaches:

Integrative Genomic Methods:

  • Genome-environment association studies: Correlate cytochrome b variants with climate variables across species ranges

  • Functional genomics integration: Combine cytochrome b sequence data with transcriptomic responses to temperature variation

  • Comparative analysis across ecological gradients: Study cytochrome b evolution across altitudinal or latitudinal clines

Advanced Evolutionary Analyses:

  • Positive selection hotspot identification: Target analysis on protein domains showing increased nonsynonymous substitution ratios

  • Convergent evolution detection: Identify parallel changes in unrelated species adapting to similar climates, as found in subterranean rodents

  • Ancient DNA applications: Compare modern and historical samples to track adaptive changes through climate shifts

Experimental Approaches:

  • Thermal performance testing: Measure metabolic efficiency of different cytochrome b variants at various temperatures

  • Oxygen affinity studies: Examine how specific mutations affect oxygen binding under different temperature conditions

  • Respiration efficiency measurement: Assess how variants perform under different oxygen concentration levels

Predictive Modeling Applications:

  • Climate change vulnerability assessment: Predict species' adaptive capacity based on cytochrome b variation

  • Ecological niche modeling: Integrate genetic data with distribution models to improve predictions

  • Evolutionary simulations: Model future evolutionary trajectories under different climate scenarios

Case Study Applications:
The Akodon olivaceus/xanthorhinus complex provides an excellent model system, as these species occupy different ecological niches (forest vs. steppe) that experience different climatic conditions . Future studies could examine how specific cytochrome b variants contribute to the adaptation of A. xanthorhinus to drier steppe environments compared to the forest-dwelling A. olivaceus, and how these adaptations might influence responses to climate change.

These approaches will advance our understanding of how mitochondrial genes contribute to climate adaptation and help predict species' responses to ongoing environmental changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.