Recombinant Albinaria coerulea Cytochrome c oxidase subunit 2 (COII)

What is the structure and function of Albinaria coerulea COII?

Albinaria coerulea COII is a 224-amino acid protein that forms part of the cytochrome c oxidase complex, the terminal enzyme in the respiratory electron transport chain. The protein contains highly conserved domains responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, which is crucial for the production of ATP during cellular respiration . The amino acid sequence (MSTWGQINLMDPASPIQMEMMLFHDHAMAILIGIFTLVSLLGVKLCFNTLSTRTMHEAQLL ETLWTILPAFLLVWLALPSLRLLYLLDEQGSEGIILKAIGHQWYWSYEMPSMNISNFDS YMIPEEDLKPGDYRLLEVDNRPMVPYGLDINVITTSADVIHAWALPSMGVKMDAVPGRLN SMGFHANLPGIYYGQCSEICGANHSFMPITVEAIDVKDFIKMCN) includes functional domains that facilitate electron transfer and membrane anchoring .

How is recombinant Albinaria coerulea COII expressed and purified for research purposes?

Recombinant A. coerulea COII is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The methodological approach involves:

• Cloning the full-length COII gene (coding for amino acids 1-224) into an expression vector

• Transforming the construct into a suitable E. coli strain

• Inducing protein expression under optimized conditions

• Lysing the cells and purifying the protein via nickel affinity chromatography

• Further purification by size exclusion chromatography if needed

• Lyophilization of the purified protein for storage

The final product is typically stored as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which maintains protein stability .

What model systems are used to study COII function?

COII function is studied using various model systems, including:

• Yeast systems (Saccharomyces cerevisiae) - Offer genetic tractability and have been used to investigate regulatory factors like Rcf1 that modulate cytochrome c oxidase activity

• Marine copepods (like Tigriopus californicus) - Provide insights into population-level variation and evolutionary selection pressures on COII

• Recombinant protein systems - Allow for in vitro biochemical characterization and electron transfer studies

• Molluscan models (including Albinaria species) - Used to investigate phylogenetic relationships and evolutionary patterns

Each system offers distinct advantages for answering specific research questions about COII structure, function, and evolution.

What methodological approaches are used to assess electron transfer kinetics in recombinant COII?

Electron transfer kinetics in recombinant COII can be assessed through multiple complementary approaches:

• Stopped-flow spectroscopy - Monitors changes in absorbance during rapid mixing of COII with electron donors or acceptors to determine reaction rates

• Oxygen electrode measurements - Quantifies oxygen consumption rates catalyzed by COII in reconstituted systems

• Cytochrome c oxidation assays - Follows the oxidation of reduced cytochrome c spectrophotometrically at 550 nm

• Steady-state kinetic analysis - Determines Vmax and Km values under varying substrate concentrations

• Flash photolysis - Used to initiate electron transfer reactions and follow subsequent electron movement

Research has shown that alterations in COII can lead to functional changes in electron transfer efficiency, with direct implications for oxygen binding and energy conservation mechanisms . For example, studies have demonstrated that regulatory factors can yield enzyme sub-populations with distinct kinetic properties, including altered midpoint potentials at the catalytic site .

How can evolutionary analysis of COII sequences inform understanding of functional constraints?

Evolutionary analysis of COII sequences provides critical insights into functional constraints through several methodological approaches:

• Phylogenetic analysis - Constructing phylogenetic trees using both mitochondrial (COI/COII) and nuclear DNA markers to understand evolutionary relationships

• Maximum likelihood models of codon substitution - Calculating the ratio of nonsynonymous to synonymous substitutions (ω) to identify selection pressures on specific codons

• Population genetics approaches - Analyzing intra- versus inter-population divergence patterns

Studies have revealed that most codons in COII are under strong purifying selection (ω << 1), reflecting functional constraints, while approximately 4% of sites may evolve under relaxed selective constraint (ω = 1) . In the marine copepod Tigriopus californicus, despite COII's critical role in electron transport, researchers observed extensive interpopulation divergence (nearly 20% at the nucleotide level), including 38 nonsynonymous substitutions . This suggests that some codons may be under positive selection to compensate for amino acid substitutions in interacting proteins.

What challenges arise in expressing functional recombinant COII and how can they be addressed?

Several methodological challenges affect the production of functional recombinant COII:

• Membrane protein solubility - COII is naturally membrane-associated, making soluble expression difficult

  • Solution: Use of specialized E. coli strains, fusion partners, or detergent solubilization

• Proper folding and post-translational modifications - Ensuring the recombinant protein adopts native conformation

  • Solution: Expression at lower temperatures (16-18°C), addition of chaperones, or use of eukaryotic expression systems

• Metal cofactor incorporation - COII function depends on proper incorporation of metal centers

  • Solution: Supplementation of growth media with appropriate metal ions and careful purification protocols

• Reconstitution of protein-protein interactions - COII functions in a multi-subunit complex

  • Solution: Co-expression with interacting partners or in vitro reconstitution experiments

• Stability during storage - Maintaining functional activity during storage

  • Solution: Addition of stabilizing agents (like trehalose) and lyophilization, avoiding repeated freeze-thaw cycles

How can researchers integrate structural and functional studies of COII?

Integrating structural and functional studies of COII requires a multidisciplinary approach:

• X-ray crystallography or cryo-EM - Determine high-resolution structures of COII alone or within the cytochrome c oxidase complex

• Site-directed mutagenesis - Modify specific residues to probe structure-function relationships

• Biophysical characterization - Use spectroscopic methods (UV-Vis, CD, fluorescence) to assess structural integrity

• Functional assays - Measure electron transfer activity and oxygen reduction capabilities

• Molecular dynamics simulations - Model protein dynamics and interactions with binding partners

These complementary approaches have revealed that alterations in COII structure can significantly impact enzyme function. For example, research on cytochrome c oxidase has identified regulatory mechanisms that alter O₂ binding and trapping, thereby affecting energy conservation by the enzyme .

What techniques are used to study COII interactions with other proteins in the respiratory chain?

Several methodological approaches are employed to study COII interactions:

• Co-immunoprecipitation - Pull down COII and identify interacting partners by mass spectrometry

• Cross-linking coupled with mass spectrometry - Identify interaction interfaces at amino acid resolution

• Surface plasmon resonance (SPR) - Measure binding kinetics between COII and partner proteins

• Isothermal titration calorimetry (ITC) - Determine thermodynamic parameters of binding interactions

• Blue native PAGE - Analyze intact respiratory complexes and supercomplexes

Studies have identified regulatory proteins such as respiratory supercomplex factor 1 (Rcf1) that bind to cytochrome c oxidase and modulate its activity . Removal of such regulatory factors can result in functionally distinct enzyme sub-populations with altered catalytic properties .

How can phylogenetic and molecular evolution analyses be applied to COII research?

Phylogenetic and molecular evolution analyses of COII involve:

• DNA extraction and PCR amplification - Isolation of genomic DNA and amplification of COII gene regions

• Sequencing - Generation of high-quality sequence data, often using both Sanger and next-generation approaches

• Sequence alignment - Alignment of sequences using algorithms that consider secondary RNA structure when applicable

• Phylogenetic tree construction - Using maximum likelihood, Bayesian, or neighbor-joining methods

• Tests of selection - Application of statistical models to identify sites under purifying, neutral, or positive selection

These approaches have been used to resolve taxonomic relationships among morphologically similar species. For example, studies on rock-dwelling mollusks have used COII sequences to verify putative morphological crypticity and identify species-level clades . In other studies, researchers identified branches in phylogenetic trees where positive selection may have occurred, consistent with functional and fitness consequences observed in hybrid populations .

How is COII used as a molecular marker in evolutionary studies?

COII serves as an important molecular marker in evolutionary studies through several methodological approaches:

• DNA barcoding - Using standardized COII fragments to identify species

• Phylogeography - Analyzing geographical distribution of genetic lineages

• Divergence time estimation - Using molecular clock methods to date evolutionary events

• Population genetics - Assessing genetic diversity within and between populations

Studies have utilized both mitochondrial (COII/COI) and nuclear markers to construct robust phylogenies . The number of variable base pair positions in COII can be substantial (148 bp in some studies), making it useful for resolving relationships at various taxonomic levels . Base pair differences within species can range from 0.6 to 10.7 in some nuclear markers, while differences between species range from 7.3 to 33.5, providing resolution for species-level discrimination .

What insights can COII provide about mitochondrial function and dysfunction?

COII research provides critical insights into mitochondrial function through:

• Enzyme kinetic studies - Measuring how COII variants affect electron transfer rates

• Oxygen consumption analyses - Quantifying respiratory capacity using oxygen electrodes

• ROS production measurements - Assessing reactive oxygen species generation

• Mitochondrial membrane potential assays - Evaluating the impact on proton gradient formation

Research has shown that alterations in COII can affect mitochondrial function by modifying:

• Electron transfer efficiency between cytochrome c and the catalytic center

• Oxygen binding and reduction at the catalytic site

• Proton pumping efficiency

• Energy conservation during respiration

These findings have implications for understanding mitochondrial dysfunction in various contexts, including adaptation to environmental conditions and potentially in disease states.