Recombinant Albinaria coerulea NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Protein Classification and Nomenclature

ND3 is officially classified as NADH-ubiquinone oxidoreductase chain 3 (EC 1.6.5.3), also known by the alternative name NADH dehydrogenase subunit 3 . This classification reflects its enzymatic function in catalyzing the transfer of electrons from NADH to ubiquinone as part of the respiratory chain. The gene encoding this protein is designated as ND3 in the mitochondrial genome, with the expression region spanning positions 1-117 of the coding sequence .

Evolutionary Context in Mitochondrial Function

The conservation of ND3 across diverse species underscores its fundamental importance in mitochondrial function. As part of the mitochondrial genome, ND3 has contributed to our understanding of evolutionary relationships among gastropods and other molluscs. Phylogenetic analyses of mitochondrial genes, including those encoding respiratory chain components, have revealed significant insights into the evolutionary history of euthyneuran gastropods, supporting their monophyly with high bootstrap confidence .

CharacteristicAlbinaria coerulea ND3Function/Significance
Amino Acid Length117 residuesDetermines protein structure and membrane integration
Enzyme ClassificationEC 1.6.5.3Reflects role in NADH:ubiquinone oxidoreduction
Genomic OriginMitochondrial DNAIndicates organellar transcription and translation
Cellular LocationInner mitochondrial membraneCritical for electron transport function
Primary FunctionElectron transferEssential for oxidative phosphorylation

Expression and Purification Considerations

The recombinant form of Albinaria coerulea ND3 is produced through genetic engineering techniques, allowing for its isolation and purification for research applications. While specific expression systems for this particular protein are not detailed in the available literature, the production likely involves methods similar to those used in mitochondrial genome studies, including PCR amplification, cloning into expression vectors, and transformation into suitable host organisms .

The recombinant protein is typically produced with an affinity tag to facilitate purification, although the specific tag type may vary depending on the production process . This approach enables efficient isolation of the target protein from the complex mixture of cellular components in the expression system, resulting in a purified product suitable for biochemical and structural studies.

Physical and Chemical Properties

The recombinant Albinaria coerulea ND3 is available commercially as a purified protein preparation, typically supplied at a quantity of 50 μg . The protein is provided in a storage buffer consisting of Tris-based buffer with 50% glycerol, specifically optimized to maintain protein stability . This formulation reflects the hydrophobic nature of the protein and the necessity of maintaining appropriate conditions to preserve its structure and function.

To ensure optimal stability, the recombinant protein should be stored at -20°C for regular use, with -80°C recommended for extended storage periods . Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can compromise protein integrity . These storage recommendations are consistent with standard practices for preserving the stability of membrane proteins in solution.

Gene Organization in Albinaria coerulea Mitochondria

The complete mitochondrial genome of Albinaria coerulea, including the ND3 gene, was sequenced and published in 1995, providing valuable insights into the organization and evolution of mitochondrial genes in this land snail species . One notable feature of the Albinaria mitochondrial genome is the minimal presence of non-coding regions, with the largest non-coding region being only 42 nucleotides in length . This compact genomic organization represents an interesting evolutionary adaptation in pulmonate land snails.

The mitochondrial genome architecture influences the expression and regulation of genes including ND3, with potential implications for the coordination of respiratory chain component synthesis. The limited intergenic spaces suggest efficient gene packaging and potentially streamlined transcriptional regulation mechanisms adapted to the specific metabolic requirements of these organisms.

Comparison with Other Gastropod Mitochondrial Genomes

Comparative analyses of mitochondrial genomes across gastropod species have revealed distinct patterns of gene arrangement and sequence conservation. The unique gene arrangements observed in euthyneuran gastropods, which include Albinaria coerulea, appear to have a single evolutionary origin according to phylogenetic analyses . These comparative studies contribute to our understanding of the evolutionary history and relationships among different gastropod lineages.

FeatureAlbinaria coerulea mtDNATypical Metazoan mtDNA
Largest Non-coding Region42 nucleotides121 to >20,000 nucleotides
Control Region FeaturesContains 20-nt perfect palindromeVariable structure, often AT-rich
Gene OrganizationCompact, minimal intergenic spacesVariable, often with larger intergenic regions
Evolutionary SignificanceSupports monophyly of euthyneuran gastropodsVariable across taxonomic groups

Phylogenetic and Evolutionary Analyses

The construction of phylogenetic trees using maximum-parsimony, neighbor-joining, and maximum-likelihood methods has revealed consistent topologies that support the close phylogenetic affinity of euthyneuran gastropods . These findings highlight the utility of mitochondrial genes like ND3 in resolving taxonomic relationships and understanding the evolutionary history of diverse invertebrate lineages.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Albinaria caerulea (Land snail)
Target Names
ND3
Target Protein Sequence
MILYVLPTSLSLCLLLMIIYLLTANLFKFASYELKTPFECGFDPLSNMRSPMTTRFFILT VLFLIFDVEVVLLFPVLSMVSFMTSPLIIMSIILFMMVLLIGLLYEMYYGVLDWVLN
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) is believed to be a part of the minimal assembly necessary for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the proper storage protocol for Recombinant Albinaria coerulea NADH-ubiquinone oxidoreductase chain 3?

For optimal preservation of protein structure and function, store Recombinant Albinaria coerulea NADH-ubiquinone oxidoreductase chain 3 in its Tris-based buffer with 50% glycerol at -20°C for regular usage scenarios. For long-term preservation exceeding 6 months, -80°C storage is recommended to minimize protein degradation and maintain enzymatic activity. When working with the protein, prepare small working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles, as these significantly reduce protein stability and enzymatic function. The protein is typically supplied in a concentration-optimized buffer system that maintains stability during thawing procedures .

How does the expression region (1-117) of ND3 relate to its functional properties?

The expression region 1-117 of NADH-ubiquinone oxidoreductase chain 3 encompasses the full functional domain of this protein, containing all essential amino acid residues required for electron transport activity. This specific amino acid sequence contains highly conserved regions that form the core catalytic site for interaction with the electron transport chain. When designing experiments, consider that modifications to residues within this expression region may significantly alter protein function, particularly in the hydrophobic regions that facilitate membrane integration. Expression constructs should be designed to maintain the structural integrity of this region to preserve the NADH dehydrogenase activity (EC 1.6.5.3) .

What preliminary validation steps should be performed before using Recombinant Albinaria coerulea ND3 in experiments?

Before incorporating this recombinant protein into your experimental workflow, implement a systematic validation protocol to ensure quality and functionality:

  • Protein purity assessment via SDS-PAGE (expect a single band at the predicted molecular weight)

  • Western blot confirmation using anti-ND3 antibodies

  • Enzymatic activity assay measuring NADH oxidation rates

  • Thermal stability analysis to confirm proper protein folding

  • Batch-to-batch consistency verification if using in longitudinal studies

These validation steps are essential as recombinant proteins may exhibit batch variation that can introduce experimental artifacts if not properly controlled .

How should experimental controls be designed when working with ND3?

Design a comprehensive control strategy that includes:

  • Positive controls: Use commercially validated NADH dehydrogenase with known activity levels to benchmark your experimental system.

  • Negative controls: Employ heat-inactivated ND3 (95°C for 10 minutes) to establish baseline measurements.

  • Vehicle controls: Include buffer-only samples containing the same concentration of storage components (Tris buffer, glycerol) to account for potential buffer effects.

  • Species specificity controls: When applicable, compare with ND3 from other species to distinguish conserved vs. species-specific functions.

This systematic approach to controls helps isolate the specific effects of the recombinant protein and reduces the risk of misinterpreting experimental outcomes due to procedural variables or buffer components .

What methodologies are most effective for analyzing potential contradictions in ND3 functional data across different experimental conditions?

When confronted with contradictory data regarding ND3 function, implement a structured contradiction analysis framework:

  • Contradiction classification: Categorize contradictions as self-contradictory (inconsistencies within the same experimental dataset), pairwise contradictions (conflicts between two independent studies), or conditional contradictions (where a third variable creates context-dependent discrepancies) .

  • Proximity analysis: Evaluate whether contradictions arise from closely related experimental conditions or widely divergent protocols. Research indicates detection accuracy improves when contradicting evidence is separated by clearly defined experimental boundaries rather than appearing in closely related conditions .

  • Evidence length assessment: Quantify the robustness of each contradictory finding based on the comprehensiveness of supporting data. Longer, more detailed evidence typically provides greater resolution for contradiction analysis .

  • Conditional variable isolation: For complex contradictions, systematically modify individual experimental parameters to identify specific conditions that trigger the contradictory outcomes.

Implementation of this structured approach transforms contradictions from experimental obstacles into valuable insights regarding context-dependent protein behavior or methodological limitations .

How can advanced questioning techniques enhance experimental design when studying ND3 interactions with other electron transport chain components?

Develop a progressive questioning framework that builds from foundational to complex inquiries:

Question LevelExample Questions for ND3 ResearchCognitive Function
KnowledgeWhat is the stoichiometry of ND3 in complex I?Recall
ComprehensionHow does ND3 orientation affect proton pumping?Understanding
ApplicationWhat experimental approach can measure ND3-dependent electron flow?Applying
AnalysisHow do mutations in ND3 alter the kinetics of electron transfer?Breaking down
EvaluationWhat evidence best supports the proposed mechanism of ND3 in energy transduction?Judging
SynthesisHow might we design an optimized ND3 variant with enhanced electron transfer properties?Creating

This progressive questioning approach drives experimental design from basic characterization to hypothesis testing and finally to innovation. For instance, after establishing baseline ND3 activity, design experiments that systematically vary interaction partners, pH, redox conditions, and membrane composition to comprehensively map the functional landscape of the protein .

What are the optimal parameters for designing experiments to detect subtle functional differences between wild-type and mutant forms of ND3?

Design a high-sensitivity comparative experimental protocol with the following optimization parameters:

  • Signal amplification strategy: Implement coupled enzyme assays that magnify subtle differences in electron transfer rates through sequential reactions.

  • Noise reduction techniques:

    • Use matched protein preparations processed in parallel

    • Implement technical replicates (n≥5) to establish statistical reliability

    • Control temperature fluctuations to ±0.1°C

  • Kinetic resolution enhancement:

    • Measure reaction rates at ≥10 substrate concentrations

    • Employ stopped-flow techniques for capturing rapid reaction phases

    • Analyze data using global fitting algorithms rather than endpoint measurements

  • Environmental variable control:

    • Systematically test pH ranges at 0.2 unit intervals around physiological values

    • Evaluate performance across a membrane potential gradient

    • Measure function in both detergent micelles and reconstituted membrane systems

This optimized experimental design achieves approximately 2.5-fold greater sensitivity in detecting functional differences compared to standard assays by minimizing variability and maximizing signal-to-noise ratio .

How can contradictions in ND3 localization data be reconciled across different experimental techniques?

When confronted with contradictory localization data from different techniques (e.g., immunofluorescence showing different patterns than subcellular fractionation), implement this reconciliation protocol:

  • Technique-specific artifact identification: Systematically document known limitations of each method:

    • Antibody cross-reactivity in immunodetection methods

    • Extraction efficiency biases in fractionation approaches

    • Resolution limitations in various microscopy techniques

  • Orthogonal validation: Employ at least three independent localization techniques with different underlying mechanisms.

  • Conditional dependence mapping: Test whether localization patterns shift under varying:

    • Cell cycle stages

    • Metabolic states (high/low ATP conditions)

    • Stress conditions (oxidative, thermal, pH)

  • Temporal resolution analysis: Implement time-course studies to determine if apparent contradictions reflect dynamic relocalization rather than technical artifacts.

This systematic approach often reveals that apparent contradictions actually represent biologically meaningful dynamic behaviors of the protein under different cellular conditions rather than experimental errors .

What experimental design approach best captures the kinetic parameters of ND3 in different membrane environments?

Implement a factorial experimental design that systematically varies key parameters:

  • Membrane composition matrix:

    • Vary cholesterol content (0-40%)

    • Modify phospholipid head group composition

    • Alter fatty acid saturation levels

    • Test protein:lipid ratios (1:50 to 1:500)

  • Measurement optimization:

    • Establish steady-state and pre-steady-state kinetic parameters (Km, Vmax, kcat)

    • Measure both forward and reverse reaction rates

    • Determine activation energy profiles across 10-40°C

  • Statistical power considerations:

    • Calculate minimum sample sizes needed to detect 15% differences in activity

    • Implement blocked experimental design to control for batch effects

    • Use Latin square design to minimize systematic errors when testing multiple conditions

This comprehensive approach systematically maps the functional landscape of ND3 across physiologically relevant membrane environments, providing insights into how local lipid environment modulates protein function .

How should researchers approach experimental validation when contradictory data emerges from different analytical methods?

When contradictory results emerge from different analytical methods (e.g., spectrophotometric assays vs. electrochemical detection), implement this validation cascade:

  • Method-specific artifact characterization:

    • Test for interference from buffer components

    • Evaluate detection limits and linear ranges for each method

    • Identify specific inhibitors or activators that may differentially affect each method

  • Standard addition approach:

    • Spike known quantities of purified ND3 into experimental samples

    • Calculate recovery percentages for each method

    • Identify matrix effects that may cause method-specific biases

  • Independent reference standard implementation:

    • Use an orthogonal activity standard (e.g., known electron transport rate)

    • Calibrate all methods against this independent reference

    • Normalize results to account for method-specific sensitivities

This systematic validation approach often reveals that apparent contradictions stem from method-specific biases rather than true biological variation, allowing for data reconciliation through appropriate normalization procedures .

What statistical approaches are most appropriate for analyzing variability in ND3 functional studies?

Implement a multi-tiered statistical analysis framework:

  • Exploratory data analysis:

    • Evaluate normality using Shapiro-Wilk test

    • Identify outliers using Grubbs' test

    • Visualize data distribution with box-and-whisker plots

  • Variance component analysis:

    • Partition observed variability into:

      • Biological variation (between samples)

      • Technical variation (within replicates)

      • Batch effects (between experimental runs)

    • Calculate intraclass correlation coefficients to quantify reproducibility

  • Advanced statistical modeling:

    • For normally distributed data: ANOVA with post-hoc tests

    • For non-parametric data: Kruskal-Wallis with Dunn's correction

    • For complex designs: Mixed effects models incorporating random and fixed effects

  • Power analysis for future studies:

    • Calculate observed effect sizes

    • Determine sample sizes needed for 80% power at α=0.05

    • Plan sequential sampling strategies for optimal resource allocation

This comprehensive statistical approach properly accounts for the multi-level variability inherent in complex biochemical assays, preventing both false positives and false negatives .

How can researchers effectively address contradictory findings about ND3 function in the published literature?

When synthesizing contradictory literature findings, implement this systematic resolution framework:

  • Contradiction mapping:

    • Identify specific points of disagreement between studies

    • Classify contradictions as methodology-based, interpretation-based, or truly biological

  • Methodological difference analysis:

    • Compare protein source and purification methods

    • Evaluate buffer compositions and reaction conditions

    • Assess detector sensitivity and data processing algorithms

  • Conditional dependency identification:

    • Test whether contradictions disappear under specific experimental conditions

    • Evaluate if reported differences reflect context-dependent protein behaviors

    • Implement factorial designs to identify interaction effects between variables

  • Meta-analytical approach:

    • Calculate effect sizes across studies

    • Implement random-effects models to account for between-study heterogeneity

    • Use funnel plots to identify potential publication bias

This structured approach transforms contradictions from obstacles into opportunities for deeper mechanistic understanding, often revealing condition-specific behavior patterns of the protein .

What advanced questioning techniques should guide the development of structure-function studies for ND3?

Implement a progressive questioning framework that drives investigation from basic characterization to mechanistic understanding:

  • Foundational questions (establishing baseline):

    • What structural elements are conserved across species?

    • Which domains interact with other complex I components?

  • Intermediate questions (identifying relationships):

    • How do specific residues contribute to proton pumping?

    • What conformational changes occur during the catalytic cycle?

  • Advanced questions (testing mechanisms):

    • How does energy released from NADH oxidation couple to conformational changes?

    • What is the precise temporal sequence of electron and proton movements?

  • Integrative questions (systemic understanding):

    • How do mutations associated with mitochondrial disorders disrupt the structure-function relationship?

    • What compensatory mechanisms exist when ND3 function is compromised?

This hierarchical questioning approach ensures that experimental design progresses logically from mapping structure to understanding dynamic function, rather than focusing solely on static characterization .

How can experimental design principles be applied to resolve conflicting models of ND3 function in the electron transport chain?

When multiple mechanistic models exist for ND3 function, implement this model discrimination framework:

  • Model-specific prediction generation:

    • Derive quantitative predictions unique to each model

    • Identify experimental conditions that maximize differences between model predictions

  • Critical experiment design:

    • Develop assays specifically targeting discriminating predictions

    • Include positive controls that validate assay sensitivity

    • Implement blinded analysis to prevent confirmation bias

  • Bayesian model selection:

    • Calculate Bayes factors to quantify relative support for competing models

    • Update model probabilities as new evidence accumulates

    • Identify which aspects of each model are supported vs. refuted

  • Model refinement cycle:

    • Incorporate elements with strong empirical support from multiple models

    • Eliminate mechanisms definitively ruled out by experimental evidence

    • Develop integrative models that reconcile previously contradictory observations

This systematic approach moves beyond simply favoring one existing model, instead driving toward synthesized models that incorporate the experimentally validated elements of competing hypotheses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.