Recombinant Albinaria coerulea NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Albinaria coerulea NADH-ubiquinone oxidoreductase chain 4L (ND4L) is a mitochondrial membrane protein integral to cellular energy production. It functions as a subunit of Complex I (NADH-ubiquinone oxidoreductase), a critical enzyme in the electron transport chain responsible for transferring electrons from NADH to ubiquinone, driving ATP synthesis. This recombinant form is engineered for research applications, enabling studies on mitochondrial dysfunction and evolutionary biology .

Protein Sequence and Domains

The full-length protein comprises 99 amino acids with the sequence:
MTIYSYLLLLCMVMFVTFFTQKNNILSLMVVLESLMLITLSSVAVSLNYMAGSSMVMILLLCFAAAEAALSLSLLVCFIQVNSSCEMLAMNKILFAKKS.

PropertyDetail
Molecular WeightPredicted ~11 kDa (unprocessed)
DomainsTransmembrane helices critical for proton translocation in Complex I.
Post-Translational ModificationsNone reported for recombinant form.

Functional Role

As part of Complex I, ND4L facilitates electron transfer from NADH to ubiquinone, establishing the proton gradient necessary for ATP synthesis. Its structural integrity is essential for catalytic activity .

Expression System

  • Host: Escherichia coli (E. coli).

  • Tag: Variable (determined during production; customizable upon request).

Purification and Stability

ParameterSpecification
Purity>85% (SDS-PAGE).
Storage (Lyophilized)-20°C/-80°C for 12 months.
ReconstitutionTris/PBS buffer with 6% trehalose; glycerol (5–50%) recommended for stability.

Therapeutic Potential

  • AI-driven conformational analysis and virtual screening (e.g., Receptor.AI) have identified ND4L as a target for small-molecule drug discovery, particularly for LHON .

  • Recombinant ND4L enables structural studies to map mutation-induced dysfunction.

Technical Considerations

  • Storage: Avoid repeated freeze-thaw cycles; aliquot for long-term stability.

  • Activity Assays: Requires integration into reconstituted Complex I for functional studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Albinaria caerulea (Land snail)
Target Names
ND4L
Target Protein Sequence
MTIYSYLLLLCMVMFVTFFTQKNNILSLMVVLESLMLITLSSVAVSLNYMAGSSMVMILL LCFAAAEAALSLSLLVCFIQVNSSCEMLAMNKILFAKKS
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), Recombinant Albinaria coerulea NADH-ubiquinone oxidoreductase chain 4L (ND4L) is believed to be part of the minimal assembly required for catalytic activity. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The enzyme's immediate electron acceptor is thought to be ubiquinone.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 4L (ND4L) and what is its role in cellular function?

ND4L is a protein subunit of NADH dehydrogenase (ubiquinone), which is located in the mitochondrial inner membrane and forms part of Complex I, the largest of the five complexes in the electron transport chain. As one of seven mitochondrially encoded subunits, ND4L plays a critical role in the core structure and function of the respiratory chain Complex I . The protein is highly hydrophobic and contributes to the formation of the transmembrane domain that is essential for proton translocation across the inner mitochondrial membrane during oxidative phosphorylation .

In Albinaria coerulea, as in other organisms, ND4L likely maintains the same fundamental roles in energy production, although species-specific variations may exist in gene structure and expression patterns similar to those observed in other freshwater snails where mitochondrial gene arrangements and codon usage show taxonomic variation .

What is the typical structure of the ND4L gene and protein?

The ND4L gene in the mitochondrial genome typically encodes a small protein of approximately 11 kDa. In humans, the MT-ND4L gene spans from base pair 10,469 to 10,765 in the mitochondrial DNA and produces a protein composed of 98 amino acids . An interesting feature of the human MT-ND4L gene is a 7-nucleotide overlap with the MT-ND4 gene, where the last three codons of ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys, and Stop) overlap with the first three codons of MT-ND4 (5'-ATG CTA AAA-3' coding for Met-Leu-Lys) .

While specific structural data for Albinaria coerulea ND4L is not explicitly provided in the available research, comparative studies of mitochondrial genomes in other mollusks suggest that gene length, codon usage, and A+T content may show variations that reflect phylogenetic relationships and evolutionary adaptations to different environments .

How does ND4L contribute to the assembly and function of Complex I?

The highly conserved nature of ND4L across species indicates its essential role in maintaining the structural integrity and functional capacity of Complex I. Mutations in this gene have been associated with various mitochondrial disorders, highlighting its importance in cellular energy production .

What are the recommended protocols for isolating and amplifying the ND4L gene from Albinaria coerulea mitochondrial DNA?

Based on methodologies used for similar mitochondrial genes in other species, researchers should consider the following protocol for isolating the ND4L gene from Albinaria coerulea:

  • Specimen Collection and Preservation: Collect specimens and store them in 100% ethanol at -40°C to preserve DNA integrity .

  • DNA Extraction: Extract total DNA using a commercial kit such as the QIAGEN DNeasy blood and tissue kit, following manufacturer's instructions .

  • Primer Design: Design primers based on conserved regions flanking the ND4L gene identified through alignment of related species. For initial amplification, use universal primers designed for mitochondrial genes, then develop species-specific primers for targeted amplification .

  • PCR Amplification: Perform PCR using a thermal cycler with the following recommended conditions:

    • Initial denaturation: 94°C for 5 minutes

    • 35 cycles of: denaturation at 94°C for 30 seconds, annealing at 48-52°C for 30 seconds, extension at 72°C for 1-2 minutes

    • Final extension: 72°C for 10 minutes

  • Sequencing and Verification: Sequence PCR products in both directions using Sanger sequencing to ensure accuracy. Verify the obtained sequence through comparison with known ND4L sequences from related species .

What expression systems are most effective for producing recombinant ND4L protein?

While the search results don't specifically address expression systems for recombinant ND4L production, based on the properties of this protein, researchers should consider:

  • Bacterial Expression Systems: E. coli-based systems with specialized vectors designed for membrane proteins may be suitable, though the hydrophobicity of ND4L may present challenges for proper folding and solubility.

  • Yeast Expression Systems: Pichia pastoris or Saccharomyces cerevisiae may provide better eukaryotic cellular machinery for the expression of mitochondrial proteins.

  • Insect Cell Systems: Baculovirus expression systems can be effective for producing membrane proteins with complex folding requirements.

  • Cell-Free Expression Systems: These may be particularly useful for hydrophobic membrane proteins like ND4L to avoid toxicity issues associated with overexpression in living cells.

For optimal expression, researchers should consider using codon optimization based on the codon usage bias observed in the target expression system, as mitochondrial genes often show distinct codon preferences compared to nuclear genes .

How can researchers analyze selection pressure on ND4L genes in comparative studies?

To analyze selection pressure on ND4L genes, researchers can apply several methodological approaches as demonstrated in studies of other mitochondrial genes:

  • Sequence the complete mitochondrial genome or at minimum the complete ND4L gene from the species of interest using established protocols for DNA extraction, PCR amplification, and sequencing .

  • Calculate the non-synonymous to synonymous substitution ratio (ω = dN/dS) using codon-based maximum likelihood methods such as the CodeML algorithm implemented in software like EasyCodeML . This ratio indicates:

    • ω = 1: neutral selection

    • ω > 1: positive selection

    • ω < 1: negative selection

  • Apply multiple model comparisons to test selection pressure:

    • Site model: Tests for selection at specific codon positions

    • Clade model: Examines selection across different clades

    • Branch model: Compares selection between specific branches of a phylogenetic tree

    • Branch-site model: Combines site and branch approaches to detect selection at specific sites in specific lineages

  • Validate results using statistical tests such as Likelihood Ratio Tests (LRTs) and Bayes Empirical Bayes (BEB) to assess model fit and evaluate the posterior probability of positive selection sites .

ModelPurposeStatistical TestInterpretation
Site modelDetects selection at specific amino acid positionsLRTIdentifies conserved vs. variable sites
Branch modelCompares selection between lineagesLRT between one-ratio (M0) and two-ratio modelsDetermines if selection differs between branches
Branch-site modelDetects selection at specific sites in specific lineagesLRT comparing model A vs. model A nullIdentifies adaptive changes in specific lineages
Clade modelExamines selection across different cladesLRTIdentifies clade-specific selection patterns

How do mutations in ND4L affect Complex I assembly and function, and what experimental approaches can be used to study these effects?

Mutations in ND4L can significantly impact Complex I assembly and function due to its core position in the transmembrane domain. To study these effects, researchers can employ multiple complementary approaches:

  • Site-Directed Mutagenesis: Introduce specific mutations into recombinant ND4L to mimic naturally occurring variants or to test hypotheses about structure-function relationships.

  • Blue Native PAGE: Use this technique to analyze the assembly of Complex I and determine whether mutations in ND4L disrupt proper complex formation.

  • Respirometry Assays: Measure oxygen consumption rates in cells expressing mutant ND4L to assess functional impacts on oxidative phosphorylation.

  • Reactive Oxygen Species (ROS) Quantification: Determine whether mutations lead to increased ROS production, which often accompanies Complex I dysfunction.

  • Mitochondrial Membrane Potential Measurements: Assess the impact of ND4L mutations on the proton gradient across the inner mitochondrial membrane.

  • Molecular Dynamics Simulations: Use computational approaches to predict how specific mutations might affect protein structure and interactions within Complex I.

Research on human MT-ND4L variants has associated certain mutations with conditions like Leber's Hereditary Optic Neuropathy (LHON) and metabolic phenotypes such as increased BMI , providing potential models for investigating structure-function relationships in this protein.

What approaches can be used to study the evolutionary conservation and divergence of ND4L across molluscan species?

To investigate evolutionary patterns of ND4L across molluscan species, researchers should consider:

  • Comprehensive Sampling: Collect mitochondrial genome sequences from diverse molluscan taxa, particularly focusing on related species within the Stylommatophora order (which includes Albinaria coerulea).

  • Sequence Alignment and Comparison: Align ND4L sequences to identify conserved and variable regions across species. Software tools like MUSCLE, MAFFT, or ClustalW can be used for this purpose.

  • Phylogenetic Analysis: Construct phylogenetic trees using methods such as Maximum Likelihood, Bayesian Inference, or Maximum Parsimony to infer evolutionary relationships.

  • Codon Usage Analysis: Examine codon usage patterns across species to identify potential selection pressures or adaptation signals. Studies in other gastropods have revealed distinct patterns of codon usage that correlate with phylogenetic relationships .

  • Gene Arrangement Comparisons: Analyze the position of ND4L relative to other mitochondrial genes, as gene rearrangements can provide valuable phylogenetic information. Software like CREx can be used to reconstruct genomic rearrangement history .

  • Structural Feature Analysis: Identify unique structural features, such as the hairpin structures observed between genes in some species , which may have functional significance or provide phylogenetic signals.

What are the challenges and solutions in purifying active recombinant ND4L for functional studies?

Purifying active recombinant ND4L presents several challenges due to its properties as a small, hydrophobic membrane protein. Researchers should consider the following approaches:

  • Optimized Detergent Selection: Test a panel of detergents to identify those that effectively solubilize ND4L while maintaining its native conformation. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often suitable for mitochondrial membrane proteins.

  • Fusion Tag Strategies: Employ solubility-enhancing tags such as MBP (maltose-binding protein), GST (glutathione S-transferase), or SUMO, with engineered cleavage sites for tag removal after purification.

  • Nanodisc Technology: Incorporate purified ND4L into nanodiscs—nanoscale phospholipid bilayers surrounded by scaffold proteins—to provide a native-like membrane environment.

  • Co-expression Strategies: Express ND4L together with interacting partners from Complex I to promote proper folding and stability.

  • Activity Verification: Develop assays to confirm that purified recombinant ND4L maintains its native structure and can properly integrate into Complex I. This might include:

    • NADH:ubiquinone oxidoreductase activity assays

    • Antibody-based detection of proper conformation

    • Proteoliposome reconstitution experiments to test functionality

  • Storage Optimization: Determine optimal buffer conditions and storage parameters to maintain protein stability over time.

How can researchers differentiate between normal variability and pathogenic mutations in ND4L sequences?

Distinguishing between neutral variations and pathogenic mutations in ND4L requires a multi-faceted approach:

  • Population Frequency Analysis: Compare variants with large databases of mitochondrial sequences to determine if a variant is common in healthy populations or associated with disease states.

  • Conservation Analysis: Assess the evolutionary conservation of the affected amino acid position across species. Mutations at highly conserved sites are more likely to be pathogenic.

  • Biochemical Property Evaluation: Consider how the amino acid change affects protein properties:

    • Hydrophobicity changes in transmembrane regions

    • Introduction or elimination of charged residues

    • Disruption of structural motifs

  • Functional Predictions: Use computational tools that predict the impact of mutations on protein function based on structural and evolutionary information.

  • Selection Pressure Analysis: Apply models like those described in section 2.3 to determine if specific regions of ND4L are under neutral, positive, or negative selection .

  • Experimental Validation: Ultimately, suspected pathogenic variants should be validated through functional studies using recombinant protein expression, cellular models, or other approaches outlined in section 3.1.

What bioinformatic tools and databases are most valuable for ND4L research?

Researchers studying ND4L can benefit from several specialized tools and databases:

  • Sequence Databases:

    • NCBI GenBank for nucleotide and protein sequences

    • MitoMap for mitochondrial DNA variations

    • MitoCarta for comprehensive mitochondrial proteome data

  • Alignment and Phylogenetic Analysis Tools:

    • MEGA for sequence alignment and phylogenetic analysis

    • PAML/CodeML for selection pressure analysis

    • EasyCodeML for simplified selection analysis workflows

  • Protein Structure Prediction:

    • AlphaFold and RoseTTAFold for protein structure prediction

    • SWISS-MODEL for homology modeling

  • Mitochondrial Genome Analysis:

    • MitoZ for mitochondrial genome assembly and annotation

    • CREx for gene rearrangement analysis

    • tRNAscan-SE for identifying and analyzing tRNA genes in mitochondrial genomes

  • Variant Interpretation Tools:

    • PolyPhen-2 and SIFT for predicting the impact of amino acid substitutions

    • MutPred for classifying amino acid substitutions

    • VarSome for aggregating multiple prediction algorithms

  • Codon Usage Analysis:

    • CodonW for analyzing codon usage patterns

    • DAMBE for sequence analysis and codon usage statistics

How can researchers integrate ND4L functional data with broader mitochondrial research?

Integrating ND4L research into the broader context of mitochondrial biology requires:

What emerging technologies are likely to advance our understanding of ND4L structure and function?

Several cutting-edge technologies show promise for advancing ND4L research:

  • Cryo-Electron Microscopy (Cryo-EM): The continued advancement of cryo-EM technology allows for increasingly detailed structural analysis of membrane protein complexes, potentially revealing new insights into how ND4L integrates into Complex I and contributes to its function.

  • Single-Particle Analysis: This technique can provide structural information about ND4L in its native environment within Complex I, potentially capturing different conformational states during the catalytic cycle.

  • Long-Read Sequencing Technologies: These methods enable more accurate sequencing of complete mitochondrial genomes, facilitating comparative genomic studies of ND4L across species.

  • CRISPR-Based Mitochondrial Genome Editing: Emerging technologies for precise editing of mitochondrial DNA could allow for targeted manipulation of ND4L to study structure-function relationships in vivo.

  • Native Mass Spectrometry: This technique can provide insights into the assembly, stoichiometry, and interactions of ND4L within Complex I under near-native conditions.

  • Molecular Dynamics Simulations: Increasingly powerful computational approaches can model the behavior of ND4L within the lipid bilayer and predict how mutations might affect its structure and function.

What are the most significant unanswered questions regarding ND4L in mollusk mitochondrial biology?

Despite ongoing research, several key questions about ND4L in mollusks remain unanswered:

  • Species-Specific Adaptations: How do variations in ND4L sequence and structure reflect adaptations to different environmental conditions across mollusk species?

  • Codon Usage Patterns: What evolutionary forces shape the distinct codon usage patterns observed in mollusk mitochondrial genes, including ND4L ?

  • Gene Arrangements: What is the functional significance of different gene arrangements involving ND4L in mollusk mitochondrial genomes, and how do these rearrangements occur evolutionarily ?

  • Selective Pressures: Are there specific regions of ND4L under positive selection in certain mollusk lineages, and how do these relate to functional adaptations?

  • Structural Features: What is the significance of unique structural features, such as the hairpin structures observed in some species' mitochondrial genomes , in relation to ND4L expression and function?

  • Complex I Assembly: How does the assembly process of Complex I in mollusks compare to that in other organisms, and what role does ND4L play in this process?

How might research on Albinaria coerulea ND4L contribute to broader understanding of mitochondrial evolution and function?

Research on Albinaria coerulea ND4L has the potential to contribute significantly to our understanding of mitochondrial biology:

  • Evolutionary Insights: As a terrestrial pulmonate gastropod, Albinaria coerulea occupies an important phylogenetic position that can shed light on mitochondrial gene evolution within mollusks and more broadly within metazoans.

  • Adaptation Mechanisms: Studying ND4L in this species may reveal adaptations related to terrestrial life, potentially identifying mechanisms for energy metabolism optimization in different environments.

  • Comparative Genomics: Comparing the structure, arrangement, and expression of ND4L in Albinaria coerulea with that in other mollusks can provide insights into mitochondrial genome evolution and the forces shaping it .

  • Structure-Function Relationships: Recombinant expression studies of Albinaria coerulea ND4L may reveal species-specific functional characteristics that contribute to our understanding of Complex I across different taxonomic groups.

  • Conservation Biology Applications: Understanding the genetic diversity and evolution of mitochondrial genes like ND4L in Albinaria coerulea, which comprises numerous endemic subspecies across the eastern Mediterranean, can inform conservation efforts for this genus.

  • Methodological Advances: Developing techniques for the recombinant expression and functional characterization of Albinaria coerulea ND4L may establish protocols applicable to other challenging mitochondrial proteins across diverse species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.