Recombinant Alcaligenes sp. Cation efflux system protein CzcD (czcD)

Shipped with Ice Packs
In Stock

Description

Biological Role in Metal Resistance

The native CzcD protein functions within the Czc system, a multi-component efflux machinery. Key roles include:

  • Regulation of CzcCBA efflux complex: CzcD represses the expression of czcCBA genes by exporting inducers (Zn²⁺, Co²⁺, Cd²⁺) from the cytoplasm, thereby reducing their intracellular concentrations .

  • Interaction with two-component systems: CzcD works alongside the CzcRS regulatory system (histidine kinase CzcS and response regulator CzcR) to fine-tune metal resistance .

  • Secondary metal efflux: While the primary efflux is mediated by the RND-type CzcCBA complex, CzcD provides baseline resistance by directly transporting cations across the cytoplasmic membrane .

3.1. Metal Transport Mechanism

  • CzcD operates as a proton-cation antiporter, utilizing the proton gradient to export Zn²⁺, Co²⁺, and Cd²⁺ .

  • Deletion of czcD leads to constitutive expression of CzcCBA due to elevated cytoplasmic metal concentrations .

3.2. Synergy with Other Efflux Systems

  • CzcCBA: Recombinant CzcD enhances the efficiency of the CzcCBA transenvelope efflux system by reducing cytoplasmic metal loads .

  • P-type ATPases: In Ralstonia metallidurans, CzcD collaborates with ATPases like ZntA and CadA for cadmium resistance, though it is dispensable for zinc detoxification .

3.3. Regulatory Interplay

  • CzcD modulates the activity of CzcRS by controlling inducer availability. For example, Zn²⁺ binding to the periplasmic domain of CzcS triggers a phosphorylation cascade that activates czcCBA transcription .

Applications and Research Implications

  • Bioremediation: Recombinant CzcD is studied for its potential in engineering metal-resistant bacterial strains for environmental cleanup .

  • Protein interaction studies: Used to investigate cross-talk between CDF transporters and RND efflux complexes .

  • Structural biology: Serves as a model for understanding metal-binding motifs in CDF proteins .

Limitations and Knowledge Gaps

  • The exact metal-binding sites and transport stoichiometry remain unresolved .

  • In vitro reconstitution of CzcD’s transport activity has not been reported, limiting mechanistic validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
czcD; Cation efflux system protein CzcD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Alcaligenes sp. (strain CT14)
Target Names
czcD
Target Protein Sequence
MGAGHSHDHPGGNERSLKIALALTGTFLIAEVVGGVMTKSLALISDAAHMLTDTVALAIA LAAIAIAKRPADKKRTFGYYRFEILAAAFNALLLFGVAIYILYEAYLRLKSPPQIESTGM FVVAVLGLIINLISMRMLSSGQSSSLNVKGAYLEVWSDLLGSVGVIAGAIIIRFTGWAWV DSAIAVLIGLWVLPRTWFLLKSSLNVLLEGVPDDVDLAEVEKQILATPGVKSFHDLHIWA LTSGKASLTVHVVNDTAVNPEMEVLPELKQMLADKFDITHVTIQFELAPCEQADAAQHFN ASPALVGSKSLAAGGN
Uniprot No.

Target Background

Function
Essential for activation of the czc determinant.
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CzcD and what is its primary function in bacterial systems?

CzcD is a membrane-bound protein belonging to the cation diffusion facilitator (CDF) protein family, which is present across all three domains of life. It plays a dual role in bacterial systems: primarily functioning as a metal ion transporter that exports cobalt, zinc, and cadmium ions across the cytoplasmic membrane, while also participating in the regulation of the Czc system that provides resistance to these heavy metals .

The CzcD protein mediates a low-level resistance to heavy metals through an efflux mechanism, although this resistance is significantly lower than that provided by the CzcCBA complex. Studies with Ralstonia sp. strain AE104 containing the CzcD-expressing plasmid pDNA176 showed growth in the presence of 100 μM cobalt, 100 μM cadmium, or 200 μM zinc, concentrations that inhibited growth in control strains . Metal accumulation experiments have confirmed that CzcD reduces intracellular concentrations of these metals, particularly zinc and cadmium, supporting its role as an active efflux transporter .

How is CzcD structurally organized within the bacterial cell membrane?

CzcD is an integral membrane protein with at least four and possibly up to six transmembrane α-helices. According to fusion protein studies, both the N-terminus and C-terminus of CzcD are likely located in the cytoplasm .

Structural analysis suggests that the first four transmembrane spans are clearly identifiable, while the existence of two additional transmembrane spans (V and VI) could not be definitively proven. As noted in the research: "The absence of hydrophobic peaks downstream of S203 and the high LacZ activity of the S203 fusion could mean a cytoplasmic localization of the C terminus of CzcD. Thus, both termini of CzcD are probably in the cytoplasm and the amino terminus is clearly followed by four transmembrane α-helices."

The inability to confirm spans V and VI may be due to limitations of the experimental methods used, or these spans might be reversibly integrated into the membrane as part of the protein's catalytic cycle or during regulatory events .

Where is the czcD gene located in Alcaligenes species and how is it organized genomically?

In Alcaligenes eutrophus (now often reclassified as Ralstonia eutropha or Cupriavidus necator), the czcD gene is located on megaplasmid pMOL30, which also carries other metal resistance determinants . The czcD gene is part of the czc determinant, which includes the structural genes czcCBA that encode the components of the high-level resistance efflux system .

The transcriptional organization of the czc system includes the czcNICBADRS genes. The czcD gene is located downstream of czcA and upstream of czcRS, which encode a two-component regulatory system . Northern blotting experiments have provided evidence for continuous transcription from czcD to czcS, but not between czcA and czcD nor between czcS and the next open reading frame .

Recent comparative genomic analysis of Alcaligenes species has revealed genes related to metal metabolism, including those for zinc and cadmium, across multiple strains, highlighting the conservation of these metal resistance mechanisms .

What are the most effective methods for detecting and quantifying CzcD-mediated metal ion transport?

Several experimental approaches can be employed to detect and quantify CzcD-mediated metal ion transport:

  • Growth assays: Compare the growth of strains with and without CzcD expression in media containing different concentrations of metal ions. This approach provides an indirect measure of transport activity .

  • Metal ion accumulation measurements: Directly measure intracellular metal concentrations using atomic absorption spectroscopy or ICP-MS (Inductively Coupled Plasma Mass Spectrometry) to provide evidence for reduced accumulation due to CzcD-mediated efflux .

  • Competitive RT-PCR: This technique has been used to quantify gene expression levels in response to metal exposure. For example, researchers measured czcCBA mRNA levels in wild-type and ΔczcD strains, revealing significant differences in expression that correlate with transport function .

  • Reporter gene fusions: Creating fusions between czcD and reporter genes like lacZ allows monitoring of czcD expression levels in response to different metal ions, which indirectly informs about transport activity .

The following table shows an example of czcCBA mRNA levels (measured as cDNA concentration) in wild-type and ΔczcD strains under uninduced and induced conditions, demonstrating the regulatory effect of CzcD on gene expression:

Bacterial strainGenotypecDNA concn (ng/g of RNA) in:Fold induction
Uninduced cellsInduced cells (Zn²⁺)
AE128(pMOL30)Wild type6, 16762, 84674
DN182(pMOL30-14)Δ czcD106, 2684,950, 10,15042

Table 1: CzcD's effect on czcCBA expression levels as measured by competitive RT-PCR

How can I create CzcD gene deletions or mutations for functional studies?

Several approaches for creating czcD deletions or mutations are described in the literature:

  • Suicide vector strategy: Clone fragments flanking the target gene into a suicide vector that cannot replicate in the target organism. After conjugation or transformation, double crossover events lead to the replacement of the wild-type gene with the mutated version .

  • Marker exchange: In studies with Ralstonia sp., researchers created Δ czcD mutants by inserting antibiotic resistance markers (like kanamycin resistance) in place of the czcD gene .

  • Reporter gene fusions: Constructing a czcC::lacZ reporter gene translational fusion and inserting it into plasmid pMOL30, as described in one study: "Construction of a pMOL30 derivative containing a czcC::lacZ reporter fusion gene instead of the czcCBAD gene region was performed in four steps: (i) a czcC::lacZ fusion gene was created, (ii) subcloned on a suicide vector, (iii) labelled with a kanamycin resistance gene, and (iv) used to replace czcCBAD with czcC::lacZ by recombination in A. eutrophus."

After creating the mutant strains, phenotypic analysis can be performed by measuring growth in the presence of various metal concentrations and by quantifying gene expression using techniques like RT-PCR .

What experimental designs are most appropriate for studying CzcD regulatory mechanisms?

When investigating CzcD regulatory mechanisms, several experimental designs prove particularly effective:

  • Factorial designs: These allow the study of multiple factors simultaneously (e.g., different metal ions, concentrations, and genetic backgrounds) to understand how various parameters affect CzcD function .

  • Response Surface Methodology (RSM): Methods like Central Composite Design (CCD) or Box-Behnken Design (BBD) can be employed to optimize experimental conditions and understand complex interactions. These approaches have been successfully used in studies with Alcaligenes species for various applications .

  • Single-case experimental designs (SCEDs): These designs focus on demonstrating experimental control of the relationship between treatment and outcome. They follow principles including randomized order of interventions, blinded intervention and data collection when possible, and appropriate replications to establish causality .

  • Time-course experiments: Monitor CzcD expression and metal resistance over time under different induction conditions. For example, researchers have shown that pre-adaptation with 300 μM zinc enables cells with intact CzcD to grow without a lag phase when subsequently exposed to 2.5 mM zinc, revealing important temporal aspects of regulation .

  • Complementation studies: Testing whether CzcD from other organisms can complement a czcD deletion provides insights into functional conservation. For instance, the czcD deletion in Ralstonia sp. could be fully complemented in trans by CzcD and two other CDF proteins from Saccharomyces cerevisiae, ZRC1p and COT1p .

How does CzcD contribute to the regulation of the Czc resistance system?

CzcD plays a complex role in the regulation of the Czc system:

  • Repressor function: Studies have shown that CzcD acts as a repressor of czc induction. When czcD is deleted, there is increased transcription of the structural czcCBA genes in both the absence and presence of inducers, suggesting that CzcD normally suppresses expression .

  • Metal ion sensing: CzcD may influence the concentration of inducing metal ions in the cytoplasm through its efflux activity, thereby affecting the activation of the regulatory system. Data shows that "CzcD represses czc induction either by inducer exclusion or by some kind of protein-protein interaction."

  • Interaction with the two-component system: CzcD functions within a regulatory network that includes CzcR (response regulator) and CzcS (sensor histidine kinase). The search results indicate that "In the current model of Czc system regulation, CzcN and CzcI may regulate the activity of a hypothetical extracellular function sigma factor while the two-component regulatory system made up of CzcR (response regulator) and CzcS (sensor histidine kinase) regulates the expression of CzcN."

Research shows that deletion of czcD leads to a 10-fold higher level of czcCBA mRNA compared to the wild-type strain under both non-induced and induced conditions (as shown in Table 1 above), providing strong evidence for its regulatory function .

What is the relationship between CzcD and the CzcCBA efflux complex?

The relationship between CzcD and the CzcCBA efflux complex is multifaceted:

  • Functional complementarity: While CzcCBA is the main high-level resistance system for cobalt, zinc, and cadmium, CzcD provides a lower level of resistance through its own metal efflux activity. For example, with CzcA alone, bacterial cells took 20 hours to grow to 300 Klett units in the presence of 200 μM Zn²⁺, while with CzcD alone, it took 125 hours to reach 200 Klett units under the same conditions .

  • Regulatory interaction: CzcD influences the expression of czcCBA genes, acting as a repressor of their transcription, as evidenced by the increased mRNA levels in ΔczcD strains .

  • System dependency: Studies with Wautersia metallidurans have shown that the high-level efflux systems CzcCBA and CnrCBA may require CDF proteins for proper functioning. In the absence of both DmeF (another CDF protein) and CzcD, the CzcCBA system was rendered completely ineffective. As noted in one study: "Thus, the absence of both Co(II)-detoxifying CDF proteins CzcD and DmeF rendered the high-level resistance-mediating efflux system CzcCBA completely ineffective."

This complex interdependence suggests that CDF proteins like CzcD may be crucial for maintaining proper metal ion homeostasis that allows the high-level resistance systems to function effectively.

How does CzcD respond to different heavy metal concentrations?

The response of CzcD to different heavy metal concentrations has been studied extensively:

  • Expression induction: The expression of czcD, like other genes in the czc system, is induced by metal ions. Northern blotting experiments have shown that "transcription was induced best by 300 μM zinc, less by 300 μM cobalt, and only slightly by 300 μM cadmium."

  • Metal specificity: While CzcD responds to multiple metals, it shows different affinities and transport efficiencies for different ions. Studies suggest it is particularly effective for zinc and cadmium export .

  • Adaptive response: Pre-exposure to lower metal concentrations enables cells with intact CzcD to respond more rapidly to subsequent exposure to higher concentrations. For example, "when wild-type and deletion strains (Δ czcD) were precultivated in the absence of Zn²⁺ or in 300 μM Zn²⁺ and then transferred to a liquid medium containing 2.5 mM Zn²⁺, the Δ czcD deletion strain started to grow immediately in both cases but the wild-type strain grew only without a lag phase when it was preadapted in the presence of 300 μM Zn²⁺."

  • Induction by various metals: Beyond the primary metals (zinc, cobalt, and cadmium), studies have shown that a czcC::lacZ reporter gene fusion under the control of CzcR was induced by other metals as well: "Zn²⁺, Co²⁺, and Cd²⁺, as well as Ni²⁺, Cu²⁺, Hg²⁺, and Mn²⁺ and even Al³⁺, served as inducers of β-galactosidase activity."

This complex response pattern suggests that CzcD is part of a sophisticated metal sensing and detoxification system that can adapt to various metal stresses in the environment.

How can contradictory findings about CzcD function in the literature be reconciled?

Reconciling contradictory findings about CzcD function requires a systematic approach:

  • Experimental context evaluation: Carefully assess the specific experimental conditions in different studies, including bacterial strains, growth conditions, metal concentrations, and experimental methods. For example, some studies used Alcaligenes eutrophus while others used Ralstonia species, which could explain some differences in CzcD function .

  • Method comparison: Different methods for assessing resistance (growth on solid media, growth curves in liquid media, survival assays) might yield different results. When analyzing contradictory findings, compare the methodological approaches used .

  • Genetic context consideration: The presence or absence of other components of the metal resistance system can influence the apparent contribution of CzcD to resistance. In Wautersia metallidurans, CzcD's function appears dependent on the presence of other CDF proteins like DmeF .

  • Temporal research evolution: The field's understanding of CzcD has evolved from its initial characterization. Early studies identified it primarily as a regulator, while later work recognized its direct transport function as well .

  • Statistical reanalysis: When faced with contradictory data, applying consistent statistical approaches across studies can help reconcile differences. Consider using contingency tables to analyze categorical variables and appropriate numerical data presentation methods for continuous variables .

  • CONTRADOC approach: Drawing from contradiction analysis methodologies used in document research, systematically categorize contradictions by type (objective vs. subjective) and scope (local vs. global) to better understand their nature and potential resolutions .

When designing experiments to address discrepancies, consider using factorial designs or response surface methodology to systematically explore the parameter space where contradictions occur .

What is the evolutionary relationship between CzcD and other cation diffusion facilitator proteins?

CzcD belongs to the cation diffusion facilitator (CDF) protein family, which is widely distributed across all three domains of life, indicating its ancient evolutionary origin and fundamental importance in metal homeostasis:

  • Cross-domain conservation: CzcD shows significant sequence similarity with CDF proteins from diverse organisms. For example, CzcD has 34% identity with the ZRC-1 protein, which mediates zinc resistance in Saccharomyces cerevisiae .

  • Functional conservation: Despite evolutionary divergence, functional conservation is evident. CzcD from Ralstonia could be complemented by CDF proteins from Saccharomyces cerevisiae (ZRC1p and COT1p), indicating functional equivalence despite evolutionary distance .

  • Subfamily classification: CzcD is part of a subfamily of the cation diffusion facilitator protein family. This subfamily likely evolved specific metal specificities and regulatory functions distinct from other CDF proteins .

  • Genomic context evolution: In Alcaligenes/Ralstonia species, czcD is often located on megaplasmids like pMOL30 alongside other metal resistance genes, suggesting potential horizontal gene transfer and co-evolution with other components of metal resistance systems .

  • Species-specific adaptations: Comparative genomic analysis of Alcaligenes species has revealed variations in metal resistance genes, including those related to zinc and cadmium metabolism, across different species and strains, reflecting adaptation to different ecological niches .

This evolutionary conservation highlights the fundamental importance of metal homeostasis mechanisms across all domains of life and suggests that CDF proteins like CzcD have been maintaining essential functions throughout evolutionary history.

How do environmental factors influence CzcD expression and function?

Environmental factors significantly impact CzcD expression and function through various mechanisms:

  • Metal ion concentrations: The most direct environmental factor affecting CzcD is the presence of metal ions. Research shows differential induction patterns: "transcription was induced best by 300 μM zinc, less by 300 μM cobalt, and only slightly by 300 μM cadmium."

  • pH effects: Since CzcD functions as a cation-proton antiporter , its activity is influenced by environmental pH, which affects the proton gradient across the membrane necessary for transport.

  • Temperature influence: Temperature affects protein folding, stability, and activity. Response Surface Methodology (RSM) approaches like Central Composite Design (CCD) have been used to optimize temperature conditions for various processes in Alcaligenes species and could be applied to study CzcD function .

  • Growth phase regulation: Bacterial physiology changes during different growth phases, affecting CzcD expression. Studies have shown that pre-adaptation in metal-containing media alters subsequent growth response in the presence of higher metal concentrations .

  • Inter-system interactions: Metal resistance systems may interact with other stress response pathways. For example, in Saccharomyces cerevisiae, the CzcD homolog ZRC1p seems to regulate glutathione biosynthesis in addition to its zinc transport function .

To systematically study these environmental influences, researchers can employ Box-Behnken Design (BBD) of Response Surface Methodology, which has been successfully used to optimize conditions for processes like Congo Red decolorization by Alcaligenes faecalis H77 .

What statistical approaches should be used to analyze variable CzcD expression data?

  • Data presentation fundamentals: Follow guidelines for presenting categorical and numerical data. As noted in one study: "For categorical variables, frequency distributions may be presented in a table or a graph, including bar charts and pie or sector charts." For numerical data, consider histograms or frequency polygon charts .

  • Contingency table analysis: When investigating relationships between categorical variables (e.g., presence/absence of CzcD vs. metal resistance), use contingency tables with appropriate calculation of relative frequencies. "The lines of this type of table usually display the exposure variable (independent variable), and the columns, the outcome variable (dependent variable)."

  • Multiple variable analysis: For complex experimental designs studying CzcD, consider factorial designs that allow examination of multiple factors simultaneously, as described in advanced experimental design approaches .

  • Response optimization statistics: When optimizing conditions for CzcD expression or function, employ Response Surface Methodology techniques. "Central Composite Design (CCD) is the most popular design in the RSM experiment. It includes up to 5 levels for each factor and is considered less sensitive than other designs to missing data."

  • Single-case experimental design analysis: For detailed studies of CzcD function under varying conditions, consider single-case experimental designs with appropriate statistical analysis methods that focus on demonstrating experimental control of the relationship between treatment and outcome .

  • Appropriate visualization: Present results in self-explanatory tables and figures with clear titles, labels, and legends. For continuous variables like CzcD expression levels, consider categorizing into intervals of equal amplitude for clearer presentation .

When analyzing gene expression data specifically, normalization methods and appropriate statistical tests based on data distribution (parametric or non-parametric) should be selected based on the specific experimental design and data characteristics.

How might CzcD be utilized in bioremediation applications?

CzcD offers several promising applications in bioremediation of heavy metal-contaminated environments:

  • Engineered bacterial strains: Bacteria overexpressing CzcD could be developed for enhanced metal uptake from contaminated soils or water. Studies have shown that even the low-level resistance provided by CzcD alone could be valuable in certain bioremediation contexts .

  • Combined resistance systems: Co-expression of CzcD with the CzcCBA complex could create synergistic effects for more efficient metal removal. Research has demonstrated that these systems work together, with CzcD potentially supporting the function of the high-level resistance system .

  • Biofilm-based remediation: Engineered biofilms expressing CzcD could provide efficient metal-binding matrices for environmental cleanup. Alcaligenes species are known to form biofilms that could serve as platforms for metal remediation .

  • Optimized expression conditions: Response Surface Methodology approaches like CCD and BBD, which have been used to optimize other processes in Alcaligenes species, could be applied to maximize CzcD-mediated metal removal efficiency under various environmental conditions .

  • Cross-species applications: The functional conservation of CDF proteins across diverse organisms suggests that CzcD homologs from different species might be utilized for specialized bioremediation applications. Studies have shown that CDF proteins from yeast can function in bacteria, suggesting flexible application potential .

Recent comparative genomic analysis of Alcaligenes species has revealed genes related to aromatic compound degradation and metal metabolism across multiple strains, highlighting the broader bioremediation potential of these bacteria beyond just heavy metal resistance .

What new research directions might advance our understanding of CzcD function?

Several promising research directions could significantly advance our understanding of CzcD function:

  • Structural biology approaches: Determining the three-dimensional structure of CzcD would provide invaluable insights into its transport mechanism and metal-binding sites. Advanced techniques like cryo-electron microscopy could be applied to resolve the structure of this membrane protein.

  • Single-molecule studies: Applying single-molecule techniques to study CzcD transport in real-time could reveal the kinetics and dynamics of metal transport and potential conformational changes during the transport cycle.

  • Systems biology integration: Investigating how CzcD functions within the broader network of metal homeostasis proteins could provide a more comprehensive understanding of its role. This could involve proteomics studies to identify interaction partners and metabolomics to understand metabolic consequences of CzcD activity.

  • Post-translational modification analysis: Identifying potential post-translational modifications of CzcD and their functional significance could reveal additional regulatory mechanisms. Mass spectrometry-based approaches would be particularly valuable for this research direction.

  • Comparative genomics expansion: Building on existing comparative genomics studies of Alcaligenes species , a broader analysis of CzcD evolution and diversification across bacterial species could provide insights into adaptation to different metal stresses.

  • Contradiction resolution studies: Applying systematic approaches to resolve contradictory findings about CzcD function, perhaps using frameworks similar to those developed for analyzing contradictions in documents , could help clarify its precise roles.

  • Advanced experimental designs: Implementing single-case experimental designs or factorial designs to systematically study CzcD under diverse conditions could reveal previously unrecognized functional aspects .

These research directions, combined with ongoing technological advances in structural biology, genomics, and systems biology, promise to provide a more complete understanding of CzcD function and its applications in biotechnology and environmental science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.