Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccB (nccB)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-Cobalt-Cadmium resistance protein NccB (NccB) is a component of the NCC cation efflux system, which confers resistance to nickel, cobalt, and cadmium .

Genetic Organization and Sequence Analysis

The nucleotide sequence of the ncc locus reveals seven open reading frames, designated nccYXHCBAN . These predicted proteins share similarities with proteins encoded by the metal resistance loci cnr (cnrYXHCBA) and czc (czcRCBAD) of A. eutrophus CH34 .

Protein Characteristics

When DNA fragments carrying ncc genes are expressed under the control of the bacteriophage T7 promoter, five protein bands are detected, representing NccA (116 kDa), NccB (40 kDa), NccC (46 kDa), NccN (23.5 kDa), and NccX (16.5 kDa) . NccB is a 40 kDa protein and a component of the NCC cation-efflux system .

Function and Mechanism

The NCC system functions as a cation-efflux system, providing resistance to nickel, cobalt, and cadmium . NccB is a component of this system. The NccN protein appears to be involved in metal specificity but affects resistance to all three metals . NccA may form a membrane tunnel, which allows ion transport across the membrane .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
nccB; Nickel-cobalt-cadmium resistance protein NccB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)
Target Names
nccB
Target Protein Sequence
MMTKNERRQPSWPMIAGVAAAAALVGFGAARGLGSPSGAEVSKLAAAPEKAAASAPAAEP AEVRIPGEYLAAANIAVEPVSAGGVGSVLLAPASVAAVPGSEAVIASRAAGAVLRIQRKL GDAVRAGDVLALVDSPEAAAMAAERKVAQARADLARKTYERESSLFQQGVTPRQEMESAR IALDVAQAEVQRAATVAQAAKVSSDGRSVAVVSPIAGRITAQSVTLGAYVAPQAELFRVA GSGAVQVEAYVTAADTSRIAAGSDATIVLANGAPLAGRVQAVTPTVSGSARAATVVVTPV DANSGLIVGEGVQVRLHTKAADANAMSVPEDAVQNLDGRDVVFVRTQQGFRPKSVLVGSR SGGVAQILSGVKPGEQVATRNAFLIKAEMNKAGGDDE
Uniprot No.

Target Background

Function

Function: A component of the NCC cation efflux system, conferring resistance to nickel, cobalt, and cadmium.

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the nccB protein and where is it found?

The nccB protein is a 397 amino acid (40 kDa) protein encoded by the nccB gene, which is part of the ncc locus found on plasmid pTOM9 of Alcaligenes xylosoxidans 31A. It functions as a component of a metal efflux system that confers resistance to nickel, cobalt, and cadmium. The ncc locus contains seven open reading frames (ORFs) designated nccYXHCBAN, with nccB being one of the critical components for functional metal resistance . The gene is located within a 14.5-kb BamHI fragment of the plasmid, and its expression is host-specific, functioning in Alcaligenes strains but not in Escherichia coli .

How does the nccB protein contribute to metal resistance?

The nccB protein works as part of a multiprotein efflux system encoded by the ncc locus. Within this system, nccB collaborates with nccC and nccA to form a functional resistance complex that exports toxic metal ions from the bacterial cell. Experimental evidence shows that Tn5 insertions in nccB cause a strong decrease in nickel-cobalt-cadmium resistance in Alcaligenes eutrophus AE104, demonstrating its essential role in the resistance mechanism . The protein likely functions as a membrane-associated component that facilitates the passage of metal ions through the cell envelope. The nccB protein shares 75% sequence identity with the CnrB protein from A. eutrophus CH34 and 31% identity with CzcB, indicating evolutionary and functional relationships with other bacterial metal resistance systems .

What is the relationship between nccB and other metal resistance proteins?

The nccB protein shows significant homology to other bacterial metal resistance proteins, particularly those in the resistance-nodulation-division (RND) family of metal transporters. Specifically:

ProteinOrganismIdentity with nccBFunction
CnrBA. eutrophus CH3475%Nickel-cobalt resistance
CzcBA. eutrophus CH3431%Cobalt-zinc-cadmium resistance

This homology suggests that these resistance systems evolved from common ancestral genes and employ similar mechanisms for metal detoxification . The ncc, cnr, and czc systems all function as tripartite RND-type efflux pumps, where proteins B and C serve as membrane fusion and outer membrane factor proteins, respectively, while protein A functions as the actual transporter component .

What experimental approaches are most effective for studying nccB function?

For studying nccB function, several methodological approaches have proven effective:

  • Transposon mutagenesis: Random Tn5 insertion mutagenesis has been successfully used to identify the role of nccB within the resistance system. By creating insertional mutations in the nccB gene and observing the subsequent loss of resistance phenotype, researchers can confirm its functional importance .

  • Heterologous expression systems: The bacteriophage T7 promoter system has been used to express nccB in controlled experimental conditions. This approach allows for the production and detection of the 40 kDa NccB protein band in expression studies .

  • Minimum inhibitory concentration (MIC) assays: Determining metal resistance levels in strains with wild-type versus mutated nccB provides quantitative measurements of the protein's contribution to resistance. This approach should use appropriate bacterial hosts, as ncc is not expressed in E. coli .

  • Comparative sequence analysis: Alignment of nccB with homologous proteins like CnrB and CzcB can identify conserved domains critical for function and provide insights into the evolutionary relationships between metal resistance systems .

  • Protein interaction studies: Co-immunoprecipitation or bacterial two-hybrid systems can be employed to study interactions between NccB and other Ncc proteins, particularly NccA and NccC, to understand the assembly and function of the resistance complex.

What factors influence the host-specific expression of nccB?

The ncc locus, including nccB, shows a remarkable host specificity pattern, functioning in Alcaligenes strains but not in E. coli . Several factors may contribute to this host specificity:

  • Regulatory elements: The ncc genes may require specific transcriptional regulators present in Alcaligenes but absent in E. coli. The presence of nccY and nccX upstream of the structural resistance genes suggests these might play regulatory roles, potentially interacting with host-specific factors .

  • Protein folding and stability: The NccB protein may require specific chaperones or membrane insertion machinery present in Alcaligenes but not in E. coli. Differences in membrane composition between bacterial species might also affect protein stability and function.

  • Interaction partners: NccB functions as part of a multiprotein complex. In E. coli, even if NccB is expressed, it may fail to interact properly with other system components due to differences in protein structures or membrane organization.

  • Post-translational modifications: Specific modifications required for NccB function might occur in Alcaligenes but not in E. coli, rendering the protein inactive in the latter.

  • Metal ion homeostasis differences: The baseline mechanisms for handling metal ions differ between bacterial species, potentially affecting how resistance proteins function in different cellular environments.

What protocols are recommended for purifying recombinant NccB protein?

Purification of recombinant NccB protein requires careful consideration of its membrane-associated nature. Based on experimental approaches used for similar proteins, the following protocol is recommended:

  • Expression system selection:

    • Use the T7 promoter system in a compatible host (Alcaligenes strains are preferred over E. coli due to host specificity issues)

    • Consider adding a purification tag (His-tag or GST-tag) to facilitate isolation

    • Optimize expression conditions (temperature, inducer concentration, duration)

  • Cell lysis and membrane fraction isolation:

    • Harvest cells and wash in appropriate buffer

    • Disrupt cells via sonication or French press

    • Separate membrane fractions through differential centrifugation

    • Solubilize membrane proteins using gentle detergents (n-dodecyl-β-D-maltoside, CHAPS, or Triton X-100)

  • Chromatography steps:

    • Affinity chromatography using the engineered tag

    • Ion exchange chromatography for additional purification

    • Size exclusion chromatography for final polishing

  • Quality control:

    • SDS-PAGE to confirm the 40 kDa band corresponding to NccB

    • Western blot using antibodies against NccB or the purification tag

    • Mass spectrometry to verify protein identity

  • Storage considerations:

    • Maintain protein in detergent micelles to prevent aggregation

    • Add glycerol (10-20%) for freeze storage

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

How can researchers effectively measure NccB-mediated metal resistance in laboratory settings?

To effectively measure NccB-mediated metal resistance, researchers should follow these methodological approaches:

  • Strain selection and preparation:

    • Use Alcaligenes eutrophus AE104 or similar compatible strains rather than E. coli

    • Prepare wild-type strains, nccB knockout mutants, and complemented strains

    • Transform strains with plasmids containing wild-type or mutated nccB

  • Minimum Inhibitory Concentration (MIC) determination:

    • Prepare gradient plates with increasing concentrations of nickel, cobalt, and cadmium chlorides

    • Adjust medium pH to 7.0 for optimal testing conditions

    • Use Tris-buffered mineral medium supplemented with gluconate for Alcaligenes strains

    • Incubate plates at 30°C for Alcaligenes strains

    • Document growth patterns after 48-72 hours

  • Metal accumulation assays:

    • Expose bacterial cultures to sublethal metal concentrations

    • Harvest cells at defined time points

    • Measure intracellular metal content using atomic absorption spectroscopy or ICP-MS

    • Compare accumulation patterns between wild-type and nccB mutant strains

  • Real-time efflux measurements:

    • Load cells with radioactive or fluorescently labeled metal ions

    • Monitor efflux rates in real-time after resuspension in metal-free medium

    • Compare efflux kinetics between strains with different nccB alleles

  • Data analysis and presentation:

    • Present MIC values in tabular format for all three metals

    • Graph metal accumulation over time for comparative analysis

    • Calculate efflux rates and statistical significance of differences between strains

What are the unexplored aspects of NccB structure-function relationships?

Several critical aspects of NccB structure-function relationships remain unexplored and represent promising avenues for future research:

  • High-resolution structure determination: Although sequence analysis has revealed homology with other metal resistance proteins, the three-dimensional structure of NccB remains undetermined. X-ray crystallography or cryo-electron microscopy studies would provide valuable insights into how NccB functions within the efflux complex.

  • Metal-binding sites: The specific amino acid residues responsible for metal ion recognition and binding in NccB are not well characterized. Site-directed mutagenesis of conserved residues, particularly histidines that might coordinate metal ions (similar to those found in NccX) , would help identify critical functional regions.

  • Interaction domains: The interfaces where NccB interacts with NccA and NccC have not been mapped. Techniques such as hydrogen-deuterium exchange mass spectrometry could identify these interaction surfaces.

  • Conformational changes during transport: How NccB changes conformation during the metal transport cycle remains unknown. Techniques such as single-molecule FRET could track these structural changes in real-time.

  • Regulatory interactions: Potential interactions between NccB and regulatory proteins like NccY and NccX have not been characterized. Bacterial two-hybrid screens or pull-down assays could identify such interactions.

How might nccB be engineered to enhance metal resistance for bioremediation applications?

Engineering nccB for enhanced metal resistance represents a promising approach for developing improved bioremediation technologies. Potential strategies include:

  • Broadening metal specificity: Structure-guided mutagenesis of metal-binding regions could expand resistance to additional toxic metals beyond nickel, cobalt, and cadmium. This approach would require identifying the specific amino acid residues involved in metal selectivity.

  • Increasing transport efficiency: Modifications to enhance the catalytic efficiency of the efflux system might be achieved through:

    • Point mutations in conserved domains

    • Fusion with energy-coupling proteins

    • Optimization of protein stability under environmental stress conditions

  • Expanding host range: Engineering nccB variants that function in diverse bacterial hosts (including E. coli) would make the system more versatile for bioremediation applications. This could involve creating chimeric proteins that combine functional domains from homologous systems that are naturally expressed in different hosts.

  • Tandem systems: Developing bacterial strains expressing multiple metal resistance systems (ncc, cnr, czc) could create "super-resistant" organisms capable of surviving and remediating environments with complex metal contamination profiles.

  • Regulatory modifications: Engineering constitutive expression or enhanced inducibility of the ncc system could improve its performance in bioremediation applications where rapid response to metal exposure is critical.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.