Recombinant Alcaligenes xylosoxydans xylosoxydans Nickel-cobalt-cadmium resistance protein nccN (nccN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nccN; Nickel-cobalt-cadmium resistance protein NccN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)
Target Names
nccN
Target Protein Sequence
MNISLRPAIAAPSPLDSFLTRHRIGIWRVVVSVVLIALITGHSQWDDTWISAALLTVGML GVTMATVGRLWCALYISGRKSTELVTTGPYSMCRHPLYVCNFVGIVGLGAMTESITLAAI LALAFALMYPAVIRSEDHLLSRNFPEFDDYARRTPAFFPRLSLFRSESTYLVHVGSFQRN LADSVWFLGMTIVVNAVELARHAKWLPTFVLLP
Uniprot No.

Target Background

Function
The NCC cation-efflux system component, nccN, confers resistance to nickel, cobalt, and cadmium. While it appears to be involved in metal specificity, it primarily affects nickel resistance. It may play a role in nickel transport.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ncc locus and what role does nccN play within it?

The ncc locus is a genetic region that encodes a high-level combined nickel, cobalt, and cadmium resistance system in Alcaligenes xylosoxydans 31A . This locus contains seven open reading frames designated as nccYXHCBAN, which together form a functional metal resistance determinant . The nccN gene encodes a 23.5 kDa protein (NccN) that was detected when DNA fragments carrying ncc genes were heterologously expressed under the control of the bacteriophage T7 promoter .

NccN functions as part of the metal resistance mechanism, though its exact role is not as well characterized as some of the other components in the system. The ncc locus is functionally similar to other metal resistance systems such as the cnr (cobalt-nickel resistance) and czc (cobalt-zinc-cadmium resistance) operons found in Cupriavidus metallidurans CH34 (formerly Alcaligenes eutrophus CH34) . The ncc system enables bacteria to tolerate high concentrations of nickel (up to 40 mM), cobalt (20 mM), and cadmium (1 mM), providing a significant survival advantage in metal-contaminated environments .

How does the ncc system differ from other heavy metal resistance determinants?

The ncc system shares similarities with other well-characterized heavy metal resistance determinants but has distinct features. Compared to the cnr system (cobalt-nickel resistance) and czc system (cobalt-zinc-cadmium resistance) from Cupriavidus metallidurans CH34, the ncc system provides resistance to a specific combination of nickel, cobalt, and cadmium .

A key distinguishing feature of the ncc system is its expression pattern - it causes high-level metal resistance in Alcaligenes eutrophus AE104 but is not expressed in Escherichia coli . This host specificity suggests regulatory mechanisms that are distinct from some other resistance systems. Additionally, the ncc locus is separated into two resistance operons with a large interspace fragment, housing both the ncc genes (conferring high-level nickel-cobalt-cadmium resistance) and the nre genes (conferring low-level nickel resistance) . This dual-operon structure represents a more complex arrangement compared to some other resistance determinants.

The predicted Ncc polypeptides show strong similarities to metal resistance proteins encoded by megaplasmids pMOL28 (cnr operon) and pMOL30 (czc operon) from Cupriavidus metallidurans CH34, suggesting a common evolutionary origin but with functional specialization .

What is the genetic structure of the ncc operon and where is nccN positioned?

The ncc operon consists of seven open reading frames (ORFs) arranged in the order nccYXHCBAN . These genes have varying functions within the resistance system. The first three genes (nccYXH) appear to play regulatory roles, similar to their homologs in other metal resistance systems . The nccCBA genes encode the structural components of the efflux pump system that actively exports metal ions from the cell .

The nccN gene is positioned at the end of this operon, following nccA. The nucleotide sequences of nccYXH and nccCBA overlap by one codon, suggesting tight genetic organization and possibly coordinated expression . Interestingly, Tn5 insertion mutations have demonstrated that the two putative resistance operons (ncc and nre) are separated by a large interspace fragment . This arrangement may have implications for the regulation and evolution of these resistance systems.

The entire ncc locus spans approximately 8 kb of DNA, as determined by mapping Tn5 insertions that affect nickel-cobalt-cadmium resistance in A. eutrophus AE104 .

What molecular techniques are most effective for studying nccN function in vivo?

To effectively study nccN function in vivo, researchers should consider a combination of genetic engineering, protein expression analysis, and phenotypic characterization approaches.

For genetic manipulation, targeted gene deletion of nccN followed by complementation studies can reveal its specific contribution to metal resistance. CRISPR-Cas9 or homologous recombination techniques can be employed to create precise deletions or modifications in the nccN gene . These mutants should then be characterized for their ability to grow in media containing various concentrations of nickel, cobalt, and cadmium ions.

For expression analysis, researchers can use reporter gene fusions (such as lacZ or GFP) to monitor nccN expression under different conditions. Additionally, RT-PCR or RNA-Seq can determine if nccN expression is induced by specific metal ions, as has been shown for nccA-like genes that are significantly induced by nickel .

Protein interaction studies using bacterial two-hybrid systems, co-immunoprecipitation, or pull-down assays can reveal whether NccN interacts with other components of the Ncc system or additional cellular proteins. For localization studies, fluorescent protein fusions or immunofluorescence microscopy can determine where NccN is positioned within the bacterial cell.

Importantly, these studies should be conducted in appropriate host organisms, as the ncc system is not expressed in E. coli but functions in Alcaligenes strains . This host specificity is a critical consideration in experimental design.

How can heterologous expression systems be optimized for studying recombinant nccN?

Optimizing heterologous expression systems for recombinant nccN requires careful consideration of several factors to ensure functional expression of this metal resistance protein.

First, select an appropriate expression host. Since the ncc system is not expressed in E. coli but functions in Alcaligenes eutrophus AE104 , consider using closely related Alcaligenes species or other β-proteobacteria as expression hosts. If E. coli expression is necessary for certain applications, specialized strains designed for expression of proteins with rare codons may improve yields.

Vector selection is also critical. Use vectors with inducible promoters that allow tight regulation of expression, as constitutive expression of metal resistance proteins might be toxic to the host. Based on previous successful approaches, the bacteriophage T7 promoter system has been effective for expressing ncc genes, resulting in detectable NccN protein (23.5 kDa) .

Optimize growth conditions by carefully controlling metal ion concentrations in the growth medium. Since NccN is involved in metal resistance, the presence of specific metal ions might affect its expression or stability. Additionally, lower growth temperatures (16-30°C) may improve protein folding and reduce aggregation.

For protein purification, consider adding affinity tags (His, FLAG, etc.) that do not interfere with protein function. Position the tag carefully to avoid disrupting functional domains. Include protease inhibitors during purification to prevent degradation, and be aware that metal-binding proteins may require specific buffer conditions to maintain stability.

Finally, verify functional activity of the recombinant protein through complementation assays in metal-sensitive strains or direct metal binding/transport assays.

What experimental approaches can determine the metal-binding properties of NccN?

Understanding the metal-binding properties of NccN requires a multi-faceted experimental approach:

Isothermal Titration Calorimetry (ITC) provides direct measurement of binding affinities, stoichiometry, and thermodynamic parameters of NccN interactions with various metal ions (Ni²⁺, Co²⁺, Cd²⁺). This technique offers valuable insights into binding preferences and mechanisms.

Spectroscopic methods are also valuable - Circular Dichroism (CD) can detect conformational changes in NccN upon metal binding, while fluorescence spectroscopy utilizing intrinsic tryptophan fluorescence or external fluorescent probes can monitor binding events. UV-Vis spectroscopy may reveal characteristic absorption patterns when metals coordinate with specific residues.

X-ray Absorption Spectroscopy (XAS) techniques like EXAFS (Extended X-ray Absorption Fine Structure) can determine the coordination environment around metal ions bound to NccN, providing atomic-level detail about binding geometries.

Structural biology approaches including X-ray crystallography or NMR spectroscopy of NccN in the presence and absence of metal ions can reveal binding sites and conformational changes. For crystallography, heavy metal soaking or co-crystallization with metals can identify binding sites.

Site-directed mutagenesis of predicted metal-binding residues (particularly histidine, cysteine, aspartic acid, and glutamic acid residues that commonly coordinate metal ions) followed by binding assays can confirm the functional importance of specific amino acids. This approach is particularly informed by the observation that NccX (another protein in the system) contains many histidine residues that possibly form metal-binding sites , suggesting that metal-coordinating residues may be a common feature in these proteins.

How does the NccN protein interact with other components of the metal resistance system?

The functional interaction of NccN with other components of the ncc metal resistance system involves a coordinated network of protein-protein interactions that facilitate metal ion efflux.

Within the ncc operon, NccC, NccB, and NccA proteins form the core of a three-component efflux pump system that spans the cell envelope of gram-negative bacteria . This arrangement is characteristic of CBA transporters, which span the whole cell wall of gram-negative bacteria . Based on similarities to other systems, NccA (116 kDa) likely functions as the RND (Resistance-Nodulation-cell Division) protein located in the inner membrane that mediates the active part of the transport process and determines substrate specificity . NccB (40 kDa) would serve as a membrane fusion protein connecting the inner and outer membrane components, while NccC (46 kDa) would form an outer membrane channel .

NccN (23.5 kDa) likely interacts with this core complex, potentially as an accessory protein that enhances functionality or provides additional regulatory control. Its specific interaction partners within the complex have not been fully characterized, but protein-protein interaction studies would help elucidate these relationships.

The regulatory proteins NccY (10.5 kDa), NccX (16.5 kDa), and NccH (21 kDa) control expression of the structural genes . Interestingly, Tn5 insertion in nccY increased nickel-cobalt-cadmium resistance, suggesting it acts as a repressor, while insertion in nccH strongly decreased resistance, indicating it functions as an activator . NccN may interact with these regulatory components to modulate the system's response to metal ions.

The exact stoichiometry and architecture of these interactions remain to be fully characterized, representing an important area for future research.

What are the known structural features of NccN and how do they relate to its function?

While detailed structural information specifically for NccN is limited in the provided search results, we can infer several features based on its relation to other components of metal resistance systems.

NccN is a 23.5 kDa protein identified through heterologous expression under the bacteriophage T7 promoter . As part of the ncc locus, it likely shares structural features with proteins in similar metal resistance systems. The protein may contain metal-binding domains, possibly rich in histidine residues as observed in NccX, which contains numerous histidines that potentially form metal-binding sites .

Based on homology to other metal resistance proteins, NccN may contain transmembrane domains if it is associated with the membrane-bound efflux system, or it might be a cytoplasmic accessory protein that interacts with the core transport components. The exact membrane topology and domain organization would need to be determined through experimental approaches such as hydropathy analysis, membrane protein topology prediction algorithms, and experimental topology mapping.

The position of nccN at the end of the operon suggests it may have emerged later in the evolution of this resistance system, potentially providing additional functionality or specificity to the core resistance mechanism. Comparative analysis with other metal resistance systems that lack nccN homologs could provide insights into its unique structural and functional contributions.

Site-directed mutagenesis experiments targeting conserved residues would help identify functionally important regions within the protein structure. Additionally, structural determination through X-ray crystallography or cryo-electron microscopy would provide definitive information about NccN's three-dimensional architecture and potential binding sites.

How does metal-induced transcriptional regulation affect nccN expression?

The ncc operon contains regulatory genes (nccYXH) that show similarities to regulatory components in other metal resistance systems . In related systems, metal ions act as co-factors that interact with metal-sensing regulatory proteins to control gene expression. Based on findings with nccA-like genes, which are significantly induced by nickel but not other metals , it's reasonable to hypothesize that nccN expression is similarly regulated in a metal-specific manner.

The mechanism likely involves metal ions binding to regulatory proteins, causing conformational changes that affect DNA binding properties. Specifically, NccH may function as an alternative sigma factor belonging to the ECF (extracytoplasmic function) subfamily, similar to CnrH in the cnr system . When activated by specific metal ions, this sigma factor could direct RNA polymerase to the promoter regions of structural genes, including nccN.

Interestingly, Tn5 insertions in nccY increased metal resistance, suggesting this protein acts as a repressor . This indicates a potential negative regulation mechanism where NccY blocks expression until appropriate metal ions are present. Conversely, insertions in nccH significantly decreased resistance, suggesting it functions as a transcriptional activator .

The entire regulatory circuit likely operates on a balance between repression and activation, fine-tuned by metal ion concentrations. This ensures that the energy-expensive resistance mechanism is only expressed when needed, allowing bacteria to efficiently adapt to varying environmental conditions.

How conserved is nccN across different bacterial species compared to other ncc genes?

The conservation of nccN across bacterial species appears to be more limited than some other components of metal resistance systems, though direct comparative data specifically for nccN is not extensively covered in the provided search results.

Metal resistance determinants show significant conservation across bacterial taxa, with similar systems found in both Gram-negative and Gram-positive bacteria . The ncc resistance system, first characterized in Alcaligenes xylosoxidans 31A, shares similarities with the cnr and czc systems from Cupriavidus metallidurans CH34 (formerly Alcaligenes eutrophus CH34) . The core components of these systems, particularly the CBA-type efflux pumps, show considerable sequence and functional conservation.

The structural genes nccCBA likely show higher conservation across species compared to nccN, as they encode the essential components of the metal efflux machinery. These proteins share strong similarities with the corresponding components in the cnr and czc systems . The RND protein component (like NccA) is particularly well conserved as it mediates the active transport process and determines substrate specificity .

Regulatory components like nccYXH may show moderate conservation, as metal-sensing regulatory systems often adapt to specific environmental niches. Accessory proteins like NccN might exhibit even more variability, potentially reflecting adaptations to specific metal stresses or physiological contexts.

Comparative genomic analysis of metal resistance determinants across bacterial species would provide more definitive information about nccN conservation. Such analysis should include examination of both sequence similarity and syntenic relationships (gene order conservation) to distinguish orthologous relationships from functional convergence.

What evolutionary insights can be gained from comparing nccN to related proteins in other metal resistance systems?

Comparative analysis of nccN with related proteins in other metal resistance systems provides valuable evolutionary insights into bacterial adaptation to metal-contaminated environments.

The ncc, cnr, and czc resistance systems likely evolved from common ancestral genes, as evidenced by the strong similarities between their encoded proteins . These systems represent specialized adaptations to different metal ion profiles, with the ncc system providing resistance to nickel, cobalt, and cadmium; cnr conferring resistance to cobalt and nickel; and czc providing resistance to cobalt, zinc, and cadmium .

The presence of nccN in the ncc operon, but potentially not in all related resistance systems, suggests it may represent a later evolutionary addition that provides enhanced functionality or specificity. Such accessory components often emerge through processes like gene duplication followed by functional divergence, horizontal gene transfer, or co-option of genes from other cellular systems.

The evolutionary pressure driving the development and maintenance of these resistance systems comes from long-term exposure to metal-contaminated environments, which creates strong selective pressure for bacteria to evolve metal resistance mechanisms . These adaptations likely developed over evolutionary time, predating human industrial activities, but have become increasingly important in anthropogenically contaminated environments.

The genomic context of these resistance determinants provides additional evolutionary insights. While many resistance genes are plasmid-borne, facilitating horizontal transfer between bacteria, some may be chromosomally encoded. For example, although the bacterium MR-CH-I2 carried a high molecular plasmid of about 50 kb, its nccA-like gene was not located on this plasmid , suggesting chromosomal integration of originally plasmid-borne resistance determinants.

How do the functional mechanisms of nccN-mediated resistance compare with other heavy metal resistance systems?

The nccN-mediated resistance mechanism shares fundamental principles with other heavy metal resistance systems while potentially offering unique functional contributions.

The core resistance mechanism in the ncc system, like in the cnr and czc systems, appears to operate through energy-dependent efflux of metal ions . These CBA transporters span the entire cell envelope of Gram-negative bacteria, with an RND protein in the inner membrane mediating the active transport process, a membrane fusion protein connecting the inner and outer membrane components, and an outer membrane protein forming the export channel . This tripartite arrangement effectively pumps toxic metal ions from the cytoplasm or periplasm to the extracellular environment.

The primary difference between these systems lies in their metal ion specificity. The ncc system confers resistance to nickel, cobalt, and cadmium; the cnr system primarily handles nickel and cobalt; and the czc system manages cobalt, zinc, and cadmium . This specificity is likely determined by subtle differences in the metal-binding sites of the transport proteins.

The role of NccN within this system requires further characterization, but it may confer additional metal specificity, enhance transport efficiency, or provide regulatory functions that fine-tune the resistance response. By comparison, other resistance systems employ various mechanisms including permeability barriers, intra- and extra-cellular sequestration, enzymatic detoxification, and reduction .

The regulatory control also differs between systems. While the ncc system is not expressed in E. coli, the nre system (which provides low-level nickel resistance) functions in both Alcaligenes and E. coli strains . This suggests differences in regulatory mechanisms that may reflect adaptation to specific environmental niches or bacterial physiologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.