Recombinant Alcanivorax borkumensis Alkane 1-monooxygenase 1 (alkB1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

The alkB1 gene is cloned into E. coli expression systems (e.g., pET26 vector) to produce soluble, active enzyme. Key steps include:

  • Gene Amplification: PCR-based isolation from A. borkumensis genomic DNA .

  • Vector Construction: Cloning with a His-tag sequence for purification .

  • Expression: Induced in E. coli BL21(DE3) cells, confirmed via SDS-PAGE and Western blot .

Bioremediation

AlkB1 enables A. borkumensis to metabolize petroleum hydrocarbons, making it a key tool for oil-spill cleanup .

Industrial Biocatalysis

  • Fuel Processing: Hydroxylation of long-chain alkanes for synthetic chemistry .

  • Pharmaceuticals: Potential use in stereoselective hydroxylation of hydrophobic substrates .

Table: Functional Advantages

FeatureRelevance
Substrate RangeBroad specificity for C₅–C₁₆ alkanes
ThermostabilityRetains activity after lyophilization and freeze-thaw cycles (with glycerol)
ScalabilityHigh-yield production in E. coli

Challenges and Optimizations

  • Membrane Localization: Requires detergent solubilization for in vitro studies .

  • Cofactor Dependency: NADPH, rubredoxin, and reductase must be co-expressed for full activity .

  • Storage Stability: Lyophilization and glycerol supplementation prevent aggregation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
alkB1; ABO_2707; Alkane 1-monooxygenase 1; Alkane hydroxylase; AHs; Terminal alkane hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
alkB1
Target Protein Sequence
MSENILTEPPRSDADNEGYVDRKRHLWILSVLWPATPIIGLYLVSQTGWSIWYGLVLILW YGLVPLIDTMLGEDYSNPPESVVPKLEQDRYYKVLTYLTVPIHYAALIISAWWVSTQPIG VFEFLALALSLGIVNGLALNTGHELGHKKETFDRWMAKLVLAVVGYGHFFIEHNKGHHRD VATPMDPATSRMGESIYTFSLREIPGAFKRAWGLEEQRLSRCGKSVWSLDNEVLQPMILT VVLYAALLAFFGPLMLIFLPIQMAFGWWQLTSANYIEHYGLLREKLPNGRYEHQKPHHSW NSNHVMSNLILFHLQRHSDHHAHPTRSYQSLRDFSDLPTLPTGYPGMFFVAFFPSWFRSL MDDRVMEWAHGDINKIQIQPGMREFYEQKFGVKGSESPDTTVAK
Uniprot No.

Target Background

Function
This enzyme catalyzes the hydroxylation of n-alkanes and fatty acids in the presence of NADH-rubredoxin reductase and rubredoxin. It exhibits a preference for hydroxylating C5-C12 hydrocarbons.
Database Links
Protein Families
Fatty acid desaturase type 1 family, AlkB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Alcanivorax borkumensis Alkane 1-monooxygenase 1 (alkB1) and what is its function?

Alcanivorax borkumensis alkB1 is an AlkB-type alkane hydroxylase that catalyzes the initial oxidation of n-alkanes in the bacterial degradation pathway. This membrane-bound enzyme belongs to a family of non-heme iron integral membrane proteins that insert oxygen atoms into alkane molecules. In A. borkumensis, alkB1 specifically oxidizes medium-chain n-alkanes ranging from C5-C12, functioning as the first enzymatic step in converting these hydrocarbons to alcohols . The terminal oxidation catalyzed by alkB1 is considered the rate-limiting step in alkane biodegradation, making this enzyme critical for the organism's ability to utilize alkanes as a carbon source.

How does the substrate range of A. borkumensis alkB1 compare to similar enzymes in other bacteria?

The substrate specificity of A. borkumensis alkB1 (active on C5-C12 n-alkanes) differs significantly from its paralog alkB2 (active on C10-C16 n-alkanes) within the same organism . This pattern of having multiple alkane hydroxylases with different substrate ranges is common among hydrocarbon-degrading bacteria. For instance:

OrganismEnzymeSubstrate RangeReference
A. borkumensis AP1AlkB1C5-C12Search result 2
A. borkumensis AP1AlkB2C10-C16Search result 2
Rhodococcus sp. CH91AlkB1C16-C36Search results 2,3
Rhodococcus sp. CH91AlkB2C16-C36 (higher activity)Search results 2,3
Acinetobacter oleivorans DR1AlkB1C24-C26Search result 2
Acinetobacter oleivorans DR1AlkB2C12-C16Search result 2

The substrate range differences reflect evolutionary adaptations to specific ecological niches and carbon sources available in different environments .

What expression systems are recommended for recombinant A. borkumensis alkB1?

For successful expression of recombinant A. borkumensis alkB1, several expression systems have proven effective for similar alkB genes:

  • E. coli-based systems: While commonly used for initial cloning, E. coli systems may require optimization for membrane protein expression. Based on protocols for similar alkB genes, plasmids like pCom8 with gentamicin selection (10 μg/ml) have been successful for alkB expression .

  • Pseudomonas fluorescens KOB2Δ1: This system has been validated for functional expression of various alkB genes, including those from Rhodococcus strains. The alkane-negative P. fluorescens KOB2Δ1 background allows for clear assessment of alkB activity without interference from native alkane degradation pathways .

  • Rhodococcus expression systems: For optimal activity, expressing alkB1 in a native-like environment such as alkane-negative Rhodococcus strains may provide better protein folding and membrane insertion .

When using these systems, it's essential to co-express the appropriate electron transfer components (rubredoxins and rubredoxin reductase) if they aren't present in the host strain, as these are required for functional alkane hydroxylase activity .

What methods are most effective for functional analysis of recombinant A. borkumensis alkB1?

For rigorous functional characterization of recombinant A. borkumensis alkB1, a multi-faceted approach is recommended:

  • Growth complementation assays: Transform the recombinant alkB1 into an alkane-negative host strain (e.g., P. fluorescens KOB2Δ1) and assess growth restoration on minimal media with various n-alkanes as sole carbon sources. This approach provides a physiological readout of functional activity .

  • Gene expression analysis: RT-qPCR can quantify transcriptional induction of alkB1 in response to different alkane substrates. For example, in Rhodococcus sp. CH91, alkB gene expression showed differential induction patterns in response to n-alkanes of varying chain lengths .

  • Alkane degradation assays: Gas chromatography can measure the disappearance of n-alkane substrates over time. For robust experimental design, compare degradation rates between:

    • Wild-type bacteria

    • alkB knockout mutants

    • Complemented strains expressing recombinant alkB

This approach has successfully demonstrated the functional roles of alkB genes in Rhodococcus sp. CH91, revealing that alkB2 plays a more significant role than alkB1 in long-chain alkane degradation .

How can I ensure proper assembly of the complete alkane hydroxylase system when expressing recombinant alkB1?

The alkane hydroxylase system requires three components for functional activity: alkane monooxygenase (alkB), rubredoxins, and rubredoxin reductase. Based on studies of rhodococcal alkane hydroxylase systems, a complete functional system requires:

  • Co-expression strategy: When expressing recombinant alkB1, co-express compatible rubredoxins and rubredoxin reductase. In Rhodococcus strains, the alkB1 gene cluster contains genes encoding two rubredoxins (rubA1 and rubA2) and a rubredoxin reductase (rubB) .

  • Component selection: Not all rubredoxins are functionally equivalent. In Rhodococcus systems, only the second rubredoxins in each gene cluster (RubA2 and RubA4) function as electron transfer components, while the first rubredoxins (RubA1 and RubA3) may have different roles .

  • Verification of protein-protein interactions: For A. borkumensis alkB1, ensure compatible electron transfer components are present, as heterologous expression may require co-expression of components from the same organism for optimal activity.

The assembly strategy should consider that the rhodococcal alkB1 gene clusters represent the only bacterial alkane hydroxylase gene clusters identified to date that encode all three components of an alkane hydroxylase system in a single operon-like structure .

What CRISPR/Cas9 strategies can be employed for studying alkB1 function through gene knockout and complementation?

Based on methodologies used for similar alkB genes, the following CRISPR/Cas9 approach can be applied to study A. borkumensis alkB1:

  • Triple-plasmid genome editing system:

    • Transform the wild-type strain with plasmid encoding Cas9 (e.g., pNV-Pa2-Cas9)

    • Introduce recombination machinery (e.g., pRCTc-Pa2-Che9c60&61)

    • Transform with sgRNA-expressing plasmid (e.g., pBNVCm-sgRNA) and linear donor dsDNA

  • Selection conditions:

    • Culture transformants on appropriate media (e.g., LB with 1% pyruvate)

    • Use appropriate antibiotic selection (e.g., kanamycin 50 μg/ml, tetracycline 10 μg/ml, and chloramphenicol 25 μg/ml)

    • Incubate at optimal temperature (e.g., 28°C for 3-5 days)

  • Confirmation of gene knockout:

    • PCR amplification of regions flanking the deletion site

    • Sequencing of the amplified regions to verify precise editing

  • Complementation analysis:

    • Clone the wild-type alkB1 gene into an expression vector

    • Transform the knockout strain with this complementation construct

    • Verify restoration of alkane degradation capability

This approach has been successfully implemented for alkB genes in Rhodococcus sp. CH91, revealing the functional redundancy and different contributions of alkB1 and alkB2 to alkane degradation .

How do growth conditions affect the expression and activity of recombinant A. borkumensis alkB1?

The expression and activity of recombinant alkB1 are influenced by several key parameters:

  • Induction conditions: The expression of alkB genes is typically induced by their alkane substrates. For A. borkumensis alkB1, exposure to C5-C12 n-alkanes would likely enhance expression. Different induction patterns may occur with different chain-length alkanes, as observed with Rhodococcus alkB genes .

  • Temperature effects: Lower temperatures (25-28°C) often improve membrane protein folding and stability compared to standard E. coli expression conditions (37°C).

  • Growth phase considerations: Expression during late exponential or early stationary phase may yield better results for membrane proteins like alkB1.

  • Media composition: Minimal media with specific alkanes as sole carbon sources can be used to study the functionality of recombinant alkB1, while rich media may be preferred for initial biomass production before induction.

RT-qPCR analyses of similar alkB genes have shown that expression levels vary significantly depending on the chain length of n-alkane inducers. For example, in Rhodococcus sp. CH91, alkB2 showed up to 58-fold increased expression when induced with C16, while alkB1 showed only about 2-fold induction with C16-C24 alkanes and 3.5-fold with C28-C36 alkanes .

What controls should be included when characterizing recombinant A. borkumensis alkB1 activity?

For rigorous characterization of recombinant A. borkumensis alkB1, include the following controls:

  • Negative controls:

    • Host strain with empty vector

    • Inactive enzyme variant (site-directed mutant of conserved histidine residues)

    • Host strain with alkB knockout

  • Positive controls:

    • Well-characterized alkane hydroxylase (e.g., P. putida GPo1 AlkB)

    • Wild-type A. borkumensis strain

  • Substrate controls:

    • Range of n-alkanes from C5-C16 to determine substrate specificity

    • Non-alkane hydrocarbons to confirm substrate selectivity

  • System completeness controls:

    • Expression of alkB1 alone

    • Expression of alkB1 with rubredoxins

    • Expression of complete system (alkB1, rubredoxins, and rubredoxin reductase)

This experimental design allows for comprehensive assessment of enzyme activity, substrate specificity, and system requirements, similar to approaches used for characterizing other alkB genes .

What approaches can resolve contradictory data in alkB1 substrate specificity studies?

When facing contradictory results regarding A. borkumensis alkB1 substrate specificity, consider these methodological approaches:

  • Multiple detection methods: Employ complementary techniques to measure activity:

    • Gas chromatography for substrate depletion

    • Mass spectrometry for alcohol product formation

    • Oxygen consumption measurements

    • NAD(P)H oxidation assays

  • Standardized substrate presentation: Alkane bioavailability varies significantly based on:

    • Solubilization method (direct addition vs. solvent carriers)

    • Substrate concentration

    • Presence of surfactants or carrier proteins

  • Mixed substrate experiments: Analyze preference when multiple alkanes are present simultaneously. Different patterns may emerge compared to single-substrate experiments, as observed with Rhodococcus sp. CH91, which showed different degradation patterns with mixed C16-C36 alkanes versus individual alkanes .

  • Genetic complementation series: Express alkB1 in multiple host backgrounds to identify potential host factors affecting substrate utilization.

By systematically addressing these variables, researchers can reconcile apparently contradictory data and develop a more nuanced understanding of substrate specificity determinants.

What sequence motifs are essential for functional activity of A. borkumensis alkB1?

The functional activity of A. borkumensis alkB1 depends on several conserved sequence features:

  • Histidine-containing motifs: Three conserved histidine motifs (His1, His2, and His3) coordinate the di-iron active site essential for catalytic activity. These typically appear as HX3-4H, HX2-3HH, and HX2-3HH patterns within the primary sequence.

  • Transmembrane domains: As an integral membrane protein, alkB1 contains multiple transmembrane helices that anchor the protein and create a hydrophobic substrate channel. Proper membrane insertion is critical for activity.

  • Rubredoxin binding regions: Specific regions of alkB1 interact with electron transfer partners (rubredoxins). These interfaces are essential for electron flow to the active site.

  • Regulatory elements: The gene expression of alkB1 is typically controlled by regulatory proteins similar to alkU1 in Rhodococcus systems, which likely belongs to the TetR family of transcriptional regulators .

Comparative analysis with other characterized alkB sequences can help identify these essential elements for site-directed mutagenesis studies to confirm their roles in substrate binding, catalysis, or protein-protein interactions.

How can structural predictions improve recombinant expression strategies for A. borkumensis alkB1?

Structural prediction tools can significantly enhance recombinant expression strategies:

  • Transmembrane topology prediction: Identify membrane-spanning regions to:

    • Design fusion constructs that don't disrupt membrane insertion

    • Determine optimal detergent selection for solubilization

    • Guide truncation strategies for crystallization attempts

  • Signal sequence analysis: Determine if native signal sequences will be recognized by the heterologous host or if substitution with host-optimized sequences is needed.

  • Protein stability assessment: Identify regions prone to misfolding or aggregation to:

    • Guide codon optimization strategies

    • Determine optimal expression temperature

    • Design stabilizing mutations or fusion partners

  • Functional domain mapping: Identify catalytic domains and interaction surfaces to ensure that tagging strategies don't interfere with essential functions.

Successful expression of alkane hydroxylases has been achieved using vectors like pCom8 for cloning and expression in hosts like E. coli (with 10 μg/ml gentamicin selection) and P. fluorescens KOB2Δ1 (with 100 μg/ml gentamicin selection) , suggesting these systems may be suitable for A. borkumensis alkB1 as well.

How can A. borkumensis alkB1 be engineered for enhanced bioremediation applications?

Engineering A. borkumensis alkB1 for improved bioremediation applications could include:

  • Substrate range expansion:

    • Site-directed mutagenesis of substrate channel residues to accommodate larger hydrocarbons

    • Directed evolution with selective pressure for growth on target pollutants

    • Creation of chimeric enzymes with domains from alkB variants with complementary substrate ranges

  • Stability enhancement:

    • Introduction of disulfide bridges for increased thermostability

    • Consensus sequence approach to identify stabilizing mutations

    • Computational design of stabilizing interactions

  • Expression optimization:

    • Codon optimization for expression in robust environmental strains

    • Development of inducible or constitutive expression systems for field applications

    • Co-expression with chaperones to improve folding in heterologous hosts

  • Activity in challenging conditions:

    • Selection for variants with improved activity in high salinity, extreme pH, or contaminated environments

    • Engineering for reduced product inhibition

The functional characteristics of alkB genes in degrading a broad range of n-alkanes make them promising candidates for engineering bacteria used in bioremediation of petroleum hydrocarbon contamination .

What are the methodological approaches for studying the regulation of A. borkumensis alkB1 expression?

To investigate the regulation of A. borkumensis alkB1 expression, consider these methodological approaches:

  • Promoter characterization:

    • Reporter gene fusions (e.g., lacZ, gfp) to the alkB1 promoter

    • Deletion analysis to identify minimal promoter elements

    • Electrophoretic mobility shift assays (EMSA) to identify protein-DNA interactions

    • DNase I footprinting to map regulatory protein binding sites

  • Regulator identification:

    • Genetic screens for regulatory mutants

    • Bacterial one-hybrid systems to identify regulatory proteins

    • Chromatin immunoprecipitation (ChIP) to identify in vivo binding

  • Environmental response mapping:

    • RT-qPCR analysis of alkB1 expression under different conditions

    • RNA-seq to identify co-regulated genes

    • Metabolite analysis to identify possible effector molecules

  • Regulatory circuit elucidation:

    • Construction of regulator gene knockouts

    • Site-directed mutagenesis of putative regulatory binding sites

    • Heterologous expression of regulatory elements

These approaches can help determine if A. borkumensis alkB1 regulation resembles the patterns observed in other bacteria, such as the different regulatory mechanisms for alkB1 and alkB2 in Rhodococcus sp. CH91, where gene expression is differentially induced by alkanes of varying chain lengths .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.