Recombinant Alcanivorax borkumensis Alkane 1-monooxygenase 2 (alkB2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant AlkB2

AlkB2 is a 382-amino acid integral membrane protein encoded by the alkB2 gene (UniProt ID: Q0VTH3). Key structural and production features include:

PropertyDetails
Expression SystemEscherichia coli BL21(DE3) with N-terminal His-tag
Molecular Weight~43 kDa (predicted)
Amino Acid SequenceMFENTNPDVMLKMKKYGYLAFWAIMVPLVPFSAFVGVESGTQDYWAWFMYAFIFGIIPVLDYLVGKDPTN...
Accessory ProteinsRequires rubredoxin (RubA) and rubredoxin reductase (RubB) for electron transfer

Recombinant AlkB2 retains functionality when heterologously expressed in E. coli, confirming its role in alkane hydroxylation . The enzyme’s activity depends on NADH as the primary electron donor, with RubA acting as an intermediate electron carrier .

Substrate Specificity and Catalytic Activity

AlkB2 exhibits distinct substrate preferences compared to its paralog AlkB1:

HydroxylaseSubstrate RangeOptimal Chain LengthElectron Transfer Partners
AlkB2C8–C16 alkanesC12–C16RubA (ABO_0163) and RubB (ABO_0162)
AlkB1C5–C12 alkanesC8–C10AlkG (ABO_2708)

Studies show AlkB2 is constitutively expressed in A. borkumensis during growth on alkanes, with transcriptional induction observed under hydrocarbon stress . Its broad substrate range includes linear, branched, and cyclic alkanes, making it critical for degrading complex oil mixtures .

Biotechnological Applications

  • Bioremediation: AlkB2 enhances crude oil degradation in marine ecosystems, particularly for medium- to long-chain hydrocarbons .

  • Industrial Biocatalysis: Potential use in biofuel production and chemical synthesis via alkane functionalization .

  • Biosensor Development: The alkB2 gene serves as a biomarker for monitoring oil-degrading bacterial populations in environmental samples .

4.1. Functional Expression in E. coli

Recombinant AlkB2 produced in E. coli retains hydroxylase activity, confirmed by whole-cell assays using NADH and RubA/RubB . SDS-PAGE and Western blot analyses verify its ~43 kDa size and His-tag fusion .

4.2. Electron Transfer Mechanism

  • Rubredoxin (RubA) directly transfers electrons from NADH to AlkB2, bypassing the need for AlkG .

  • Rubredoxin reductase (RubB) catalyzes NADH oxidation, regenerating reduced RubA for sustained AlkB2 activity .

4.3. Regulatory Insights

  • AlkB2 expression is regulated independently of AlkB1, responding to distinct environmental signals .

  • Cytochrome P450 systems (e.g., CypR) and global regulators like the Cyo terminal oxidase modulate AlkB2 activity under varying hydrocarbon conditions .

Future Directions

  • Structural Studies: X-ray crystallography to resolve AlkB2’s membrane-bound conformation .

  • Metabolic Engineering: Optimizing AlkB2 expression in industrial strains for scalable alkane conversion .

  • Environmental Monitoring: Deploying alkB2-specific biosensors to assess oil spill remediation efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
alkB2; ABO_0122; Alkane 1-monooxygenase 2; Alkane hydroxylase; AHs; Terminal alkane hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
alkB2
Target Protein Sequence
MFENTNPDVMLKMKKYGYLAFWAIMVPLVPFSAFVGVESGTQDYWAWFMYAFIFGIIPVL DYLVGKDPTNPSEDVQVPTMSEEVFYRVSAIAMGFVWIAVLFYAGHIFMNNGYGLLGKIG WIVSIGTVGGIIAINLGHELIHKDPKVENWMGGLLLSSVTYAGFKVEHVRGHHVHVSTPD DASSSRYNQSLYNFLPKAFVHNFINAWSLEKKYLERKGKKNISVHNELIWWYSISALFAA TFGLLWGWQGVVFFLGQSFFAALALEIINYIEHYGLHRRVNDKGRFERVTPAHSWNSNFL LTNLALFQLQRHSDHHAYAKRRYQVLRHYEESPQLPAGYATMYVLALIPPLWRKVMNPRV EAYYEGELDQLFRDGKRVNNIA
Uniprot No.

Target Background

Function
Catalyzes the hydroxylation of n-alkanes in the presence of NADH-rubredoxin reductase and rubredoxin. It preferentially hydroxylases C8-C16 hydrocarbons.
Database Links
Protein Families
Fatty acid desaturase type 1 family, AlkB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Alcanivorax borkumensis and why is it significant for bioremediation research?

Alcanivorax borkumensis is a marine bacterium highly specialized in degrading linear and branched alkanes, playing a key ecological role in the removal of marine oil spills . This organism has garnered significant attention due to its remarkable capacity to utilize hydrocarbons as its primary carbon source. The bacterium's genome contains multiple enzyme systems specifically evolved for alkane degradation, including two integral membrane alkane hydroxylases (AlkB1 and AlkB2) and three cytochrome P450s . These enzymatic systems collectively enable A. borkumensis to efficiently metabolize various components of crude oil, making it a dominant species in oil-contaminated marine environments. The study of A. borkumensis provides valuable insights into natural bioremediation processes and offers potential biotechnological applications for enhancing oil spill cleanup efforts.

How does AlkB2 function within the alkane degradation pathway?

AlkB2 functions as a hydroxylating enzyme within the alkane degradation pathway of A. borkumensis . As an integral membrane alkane hydroxylase, AlkB2 catalyzes the initial and often rate-limiting step in alkane metabolism: the terminal oxidation of alkanes to alcohols. This reaction involves the incorporation of one oxygen atom from molecular oxygen (O₂) into the alkane substrate. The enzymatic system requires electron transfer components, specifically rubredoxin (RubA) as an intermediate electron donor and rubredoxin reductase (RubB) as the initial electron donor that utilizes NADH . Research has demonstrated that recombinant AlkB2 is produced in an active form and that rubredoxin effectively transfers electrons to AlkB2, even replacing the function of AlkG when NADH serves as the primary electron donor . This electron transfer chain is essential for the hydroxylation reaction catalyzed by AlkB2.

What experimental approaches are recommended for studying AlkB2 substrate specificity?

To study AlkB2 substrate specificity, researchers should employ a systematic approach combining expression of the recombinant enzyme with various methods for activity assessment. Based on successful experimental designs from the literature, the following methodology is recommended:

  • Heterologous expression in E. coli, specifically using strains such as BL21(DE3)plysS that are optimized for membrane protein expression .

  • Co-expression with accessory proteins (rubredoxin and rubredoxin reductase) to ensure a functional electron transfer system .

  • Growth assays using recombinant strains on various n-alkanes (ranging from C8 to C16) as sole carbon sources to determine the substrate range .

  • Mineralization assays using 14C-radiolabeled alkanes to quantitatively measure complete oxidation capacity for specific chain-length alkanes .

  • Enzyme activity assays measuring the conversion of alkanes to corresponding alcohols using gas chromatography-mass spectrometry (GC-MS).

Researchers should note that membrane protein purification may present challenges, and activity assays in whole cells or membrane fractions may provide more reliable results than with purified enzyme preparations.

What expression systems have proven effective for recombinant AlkB2 production?

The expression of functional recombinant AlkB2 has been successfully achieved in Escherichia coli, particularly using the BL21(DE3)plysS strain . This expression system has demonstrated the capacity to produce AlkB2 in an active form capable of hydroxylating alkanes when the appropriate accessory proteins are present. The comprehensive approach involves:

  • Cloning the alkB2 gene from A. borkumensis SK2 into suitable expression vectors.

  • Co-expression with rubredoxin (RubA) and rubredoxin reductase (RubB) genes, which are necessary for electron transfer during the hydroxylation reaction .

  • Using vectors containing inducible promoters, such as the P. putida GPo1 alkBp promoter found in plasmids like pCom8 .

  • Incorporating selection markers such as gentamicin resistance for identification and maintenance of recombinant strains .

It is noteworthy that heterologous expression in Pseudomonas strains has also been demonstrated for alkane hydroxylases, with P. fluorescens KOB2Δ1 successfully hosting recombinant alkB genes and demonstrating growth on medium-chain alkanes .

What are the critical factors for maintaining AlkB2 activity during expression and purification?

Maintaining the activity of recombinant AlkB2 during expression and purification requires careful attention to several critical factors:

  • Membrane integration: As an integral membrane protein, AlkB2 requires proper insertion into cell membranes to maintain its native conformation and function . Expression conditions should be optimized to facilitate correct membrane insertion.

  • Electron transfer components: The co-expression of electron transfer proteins, specifically rubredoxin (RubA) and rubredoxin reductase (RubB), is essential for AlkB2 activity . Research has demonstrated that rubredoxin serves as the intermediate electron donor to AlkB2 and can replace AlkG function when NADH is the prime electron donor .

  • Gentle extraction methods: During purification, detergent selection is crucial for solubilizing the membrane-bound enzyme without denaturation. Mild detergents at carefully optimized concentrations should be employed.

  • Oxidative protection: Maintaining reducing conditions during purification helps prevent oxidative damage to the iron-containing active site of AlkB2.

  • Temperature control: Performing expression at lower temperatures (e.g., 20-25°C) may enhance proper folding and membrane insertion of the recombinant protein.

How is alkB2 gene expression regulated in A. borkumensis?

The regulation of alkB2 gene expression in A. borkumensis involves complex mechanisms responding to substrate availability and environmental conditions. Recent research has identified CrgA as a protein that represses the AlkB2 monooxygenase and regulates its expression . Statistical analyses have been performed examining the transcriptional levels of the alkB2 gene in strain SJTD-1 when cultured with glucose versus different n-alkanes .

The regulatory mechanisms appear to include:

  • Transcriptional repression by CrgA protein, which has been shown to bind to the upstream region of the alkB2 gene .

  • Substrate-dependent induction, with different n-alkanes potentially influencing expression levels differently.

  • Metabolic regulation, with glucose potentially exerting catabolite repression on alkB2 expression.

Understanding these regulatory mechanisms is critical for optimizing recombinant expression systems and for developing strategies to enhance alkane degradation capabilities in bioremediation applications.

What molecular techniques are most effective for studying alkB2 gene regulation?

For studying alkB2 gene regulation, several molecular techniques have proven particularly effective:

  • Electrophoretic Mobility Shift Assay (EMSA): This technique has been successfully used to study the binding of regulatory proteins like CrgA to the upstream regions of the alkB2 gene . The protocol involves:

    • Amplifying DNA fragments containing potential regulatory regions using PCR with FAM-labeled primers for longer fragments (>100 bp)

    • For shorter fragments (<100 bp), annealing two paired oligonucleotides

    • Incubating purified regulatory proteins with labeled DNA fragments at different molecular ratios

    • Analyzing protein-DNA complexes using native PAGE and visualization systems

  • Promoter activity assays: Using reporter gene constructs to measure promoter activity under different conditions, such as exposure to various alkanes or in the presence/absence of regulatory proteins.

  • RT-qPCR analysis: Quantitative measurement of alkB2 transcript levels under various growth conditions, including different carbon sources and environmental factors .

  • Gene knockout and complementation studies: Creating mutants lacking specific regulatory genes to determine their effect on alkB2 expression, followed by complementation to confirm the role of the regulatory gene.

These techniques provide comprehensive insights into the complex regulatory networks controlling alkB2 expression in A. borkumensis.

What is the substrate specificity profile of AlkB2 compared to other alkane hydroxylases?

The substrate specificity of AlkB2 from A. borkumensis appears to differ from that of other alkane hydroxylases, reflecting specialized adaptations for degrading particular ranges of alkanes. While the precise substrate range of A. borkumensis AlkB2 requires more detailed investigation , comparative studies with other alkane hydroxylase systems provide valuable insights:

  • Recombinant systems containing rhodococcal alkB2 (from a different organism) have demonstrated the ability to mineralize and grow on C12 to C16 n-alkanes , suggesting medium-chain alkane preference.

  • In A. borkumensis, the multiple alkane degradation systems (including two AlkB hydroxylases and three P450 cytochromes) likely have evolved to handle different ranges of hydrocarbon substrates .

  • Studies of P. putida GPo1 AlkB (a well-characterized alkane hydroxylase) show preference for C5-C12 n-alkanes, providing a reference point for comparison.

It is notable that A. borkumensis contains multiple enzyme systems for terminal hydroxylation of alkanes, suggesting that AlkB2 may have evolved specificity for a particular subset of alkanes, complementing the activities of AlkB1 and the cytochrome P450 systems .

How do the accessory proteins rubredoxin and rubredoxin reductase interact with AlkB2?

The interaction between AlkB2 and its accessory proteins, rubredoxin (RubA) and rubredoxin reductase (RubB), is critical for enzymatic function. Research has established that:

  • Rubredoxin serves as the intermediate electron donor to AlkB2 and can functionally replace AlkG when NADH is the prime electron donor .

  • The electron transfer pathway follows the sequence: NADH → rubredoxin reductase (RubB) → rubredoxin (RubA) → AlkB2 → alkane substrate.

  • A. borkumensis contains multiple rubredoxin genes (rubA1, rubA2, rubA3, rubA4) that have been cloned and characterized , potentially providing flexibility in electron transfer systems.

  • Functional studies have demonstrated that recombinant AlkB2 produced in E. coli requires the co-expression of these accessory proteins for activity .

The molecular details of these protein-protein interactions remain to be fully elucidated, but the functional dependency of AlkB2 on these electron transfer components has been clearly established through recombinant expression studies .

What are the most promising approaches for engineering enhanced AlkB2 variants for bioremediation?

Engineering enhanced AlkB2 variants for bioremediation applications represents an advanced research frontier. Based on current understanding of AlkB2 and related alkane hydroxylases, several promising approaches emerge:

The success of these approaches will depend on developing robust high-throughput screening methods to identify variants with desired properties from large libraries of engineered enzymes.

How can researchers overcome challenges in studying the membrane-bound nature of AlkB2?

The membrane-bound nature of AlkB2 presents significant challenges for structural and functional studies. Researchers can employ several specialized approaches to overcome these difficulties:

  • Nanodiscs technology: Incorporating purified AlkB2 into nanodiscs (disc-shaped phospholipid bilayers stabilized by scaffold proteins) provides a native-like membrane environment for functional and structural studies.

  • Detergent screening: Systematic evaluation of different detergents and solubilization conditions to identify optimal parameters for extracting active AlkB2 from membranes without compromising activity.

  • Whole-cell assays: Developing whole-cell activity assays that circumvent the need for protein purification while still allowing quantitative assessment of AlkB2 function.

  • Membrane fraction studies: Working with isolated membrane fractions containing AlkB2 rather than attempting complete purification, particularly for activity assays.

  • Computational approaches: Utilizing computational modeling and simulations to predict structural features and substrate interactions of AlkB2 based on homology to better-characterized membrane proteins.

  • Cryo-electron microscopy: Applying advanced cryo-EM techniques specifically optimized for membrane protein complexes to obtain structural information.

These approaches can be complementary, providing a multi-faceted understanding of AlkB2 structure and function despite its challenging membrane-bound nature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.