Recombinant Alcanivorax borkumensis Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Biological Role

Alcanivorax borkumensis dsbB belongs to the DsbB family of membrane-integrated oxidoreductases. Its primary function is to regenerate the oxidized form of DsbA (a periplasmic thiol-disulfide oxidase) by transferring electrons to ubiquinone, thereby enabling DsbA to introduce disulfide bonds into nascent secretory proteins . This system is essential for the maturation of extracellular enzymes, including alkane hydroxylases (e.g., AlkB1/AlkB2) involved in hydrocarbon degradation .

Production and Biochemical Properties

The recombinant dsbB is heterologously expressed in Escherichia coli and purified for research use.

Functional Mechanism

  • Electron Transfer: DsbB oxidizes DsbA via a quinone-dependent mechanism. In E. coli, the N-terminal cysteine pair (Cys41/Cys44) forms a disulfide upon quinone reduction, which is subsequently transferred to the C-terminal pair (Cys104/Cys130) and then to DsbA .

  • Redox Potential: While A. borkumensis dsbB’s exact redox potential is unreported, E. coli DsbB disulfides exhibit potentials of ~-271 mV and -284 mV, far less oxidizing than DsbA’s -120 mV .

Role in Hydrocarbon Degradation

Alcanivorax borkumensis is renowned for its alkane-degrading capacity, mediated by integral membrane alkane hydroxylases (AlkB1/AlkB2). The dsbB-DsbA system ensures proper folding of these enzymes, as demonstrated in studies where recombinant AlkB2 required accessory proteins (rubredoxin/rubredoxin reductase) for activity .

Table 2: Redox Potentials of DsbA Proteins (Representative Bacteria)

OrganismDsbA ProteinRedox Potential (mV)Key Features
E. coliDsbA-122CPHC motif, high oxidizing power
Vibrio choleraeDsbA-116Class I, hydrophobic groove
Salmonella entericaSrgA-154CPPC motif, lower oxidizing
Wolbachia pipientisDsbA1-163CYHC motif, reduced oxidizing

Heterologous Expression

  • Membrane Integration: Native DsbB is a transmembrane protein; solubility engineering (e.g., SIMPLEx fusion systems) may enhance cytoplasmic expression .

  • Activity Confirmation: Functional assays (e.g., DsbA oxidation or alkane hydroxylase activity) are required to validate recombinant protein integrity .

Mechanistic Controversies

Debate persists about whether DsbB oxidizes DsbA via thiol-disulfide exchange or direct quinone reduction. Studies in E. coli suggest the latter, as cysteine mutants retain partial activity . Further research is needed to clarify A. borkumensis dsbB’s mechanism.

Applications in Biotechnology

The recombinant dsbB has potential in:

  • Bioremediation: Enhancing hydrocarbon degradation by optimizing alkane hydroxylase folding.

  • Antimicrobial Development: Targeting DsbB-DsbA pathways in pathogens (e.g., Salmonella) .

  • Protein Engineering: Designing dsbB variants for cytoplasmic disulfide bond formation in biocatalysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments default to blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage state, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; ABO_0262; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
dsbB
Target Protein Sequence
MSSIIPAPRPLNALAFLACLAAIVGALYLQHVDGLEPCPLCIFQRVGVIAGAVILLIASL HGPKNIGVRIYGALTTLAALGGGAVAARHIWLQNLPADQVPACGPGLDYMLEVFPLQNVL QQVLAGSGECAEMDWSFLGLSLPGWSMVVFAGLLLVGLIQMFRPLTR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Alcanivorax borkumensis and why is it significant for research?

Alcanivorax borkumensis is a ubiquitous marine petroleum oil-degrading bacterium with a highly specialized physiology optimized for alkane metabolism. This "hydrocarbonoclastic" bacterium has gained significant research interest due to its exceptional ability to degrade an extraordinarily broad range of alkane hydrocarbons while utilizing very few other substrates. The bacterium dramatically increases in abundance following oil spills, often becoming the predominant microorganism in oil-polluted marine environments. The organism has been isolated from numerous oil spill sites globally, with its list of isolation locations continuously expanding as microbiological investigations of oil spills progress. Its unusual metabolic characteristics, presumed global importance in natural biological oil remediation, and biotechnological potential for mitigating ecological damage from oil spills have stimulated significant functional genomic studies.

What is the biological function of Disulfide bond formation protein B (dsbB) in bacterial systems?

Disulfide bond formation protein B (dsbB) plays a critical role in the oxidative protein folding pathway. It functions as a membrane-bound oxidoreductase that recycles the disulfide bond-forming enzyme DsbA. The DsbB protein accepts electrons from reduced DsbA and transfers them to quinones in the electron transport chain, thus maintaining DsbA in its oxidized, active state. This catalytic cycle is essential for the proper formation of disulfide bonds in periplasmic and secreted proteins, which are critical for their structural integrity and function. In the specific context of Alcanivorax borkumensis, DsbB likely contributes to the proper folding of proteins involved in its specialized hydrocarbon metabolism pathways, although the specific proteins affected would require experimental verification.

What structural features characterize the DsbB protein?

DsbB is characterized as a polytopic α-helical membrane protein. Structural studies using NMR spectroscopy have revealed that DsbB contains multiple transmembrane segments with important functional regions. The protein contains conserved cysteine residues that participate in disulfide exchange reactions essential for its catalytic activity. Due to its membrane-embedded nature, DsbB must be extracted from its native bilayer environment and stabilized in membrane mimetic environments (typically detergent micelles) for structural studies. This presents significant challenges for structural determination by either X-ray crystallography or NMR spectroscopy. The resulting protein-detergent complexes are large by solution NMR standards and require extensive deuteration of the protein to enhance the performance of NMR experiments necessary for backbone resonance assignment.

What are the optimal conditions for expressing and purifying recombinant Alcanivorax borkumensis DsbB?

For optimal expression and purification of recombinant A. borkumensis DsbB, researchers should consider a systematic approach similar to methods used for other DsbB proteins. The gene encoding DsbB can be amplified using PCR and cloned into an expression vector such as pET-based systems under control of the T7 promoter. Expression in E. coli should be optimized by testing various strains (BL21(DE3), C41(DE3), or C43(DE3) which are better suited for membrane proteins), induction conditions (IPTG concentration, temperature, and duration), and growth media.

For purification, a multi-step approach is recommended:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Membrane isolation through ultracentrifugation

  • Solubilization of membrane proteins using appropriate detergents (DDM, LMNG, or OG)

  • Affinity chromatography using engineered tags (His6, etc.)

  • Size exclusion chromatography for final purification

The protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week.

What NMR spectroscopy approaches are most effective for studying DsbB structure and function?

NMR spectroscopy for DsbB structural studies requires sophisticated approaches due to the challenging nature of membrane proteins. The most effective methodology involves:

  • Sample preparation with isotopic labeling: Extensive deuteration (2H, 13C, 15N-labeled) with selective methyl protonation (ILV - isoleucine, leucine, valine) is essential to enhance the performance of NMR experiments.

  • Data collection strategy: A hybrid approach is recommended:

    • First, determine the structure of individual secondary structure elements (transmembrane helices and loops) using chemical shift-derived backbone torsion angles, residual dipolar couplings (RDCs), and sequential/medium-range NOEs.

    • Then, fix these elements using experimentally verified hydrogen bond restraints and restrictive backbone torsion angle restraints.

    • Finally, fold these segments together using RDC data, paramagnetic relaxation enhancement (PRE) data, and long-range methyl NOE restraints.

  • Complementary measurements: Collect multiple types of structural constraints including:

    • Distance constraints from NOEs (intra-residue, sequential, medium-range, and long-range)

    • Dihedral angles derived from chemical shifts

    • Hydrogen bonds

    • Paramagnetic relaxation enhancements from multiple nitroxide-labeled samples

    • Residual dipolar couplings

This comprehensive approach yields high-resolution structures of membrane proteins like DsbB despite their inherent challenges in NMR studies.

What experimental controls are essential when studying the enzymatic activity of DsbB?

When studying DsbB enzymatic activity, several essential controls must be incorporated:

  • Negative controls:

    • Denatured DsbB protein to confirm activity loss

    • DsbB with active site cysteines mutated to serines

    • Reaction mixture lacking essential components (e.g., ubiquinone)

  • Positive controls:

    • Well-characterized DsbB from model organisms (e.g., E. coli DsbB)

    • Complementation assays in dsbB-deficient strains

  • Specificity controls:

    • Alternative substrates to assess specificity

    • Inhibitor studies to confirm mechanism

  • Environmental controls:

    • pH optimization experiments (typically pH 5.5-8.0)

    • Temperature dependency assays

    • Detergent/lipid composition variations

  • Kinetic controls:

    • Time-course experiments to ensure linear reaction rates

    • Substrate concentration series for Michaelis-Menten parameters

These controls ensure that any observed activity is specifically attributed to the catalytic function of DsbB and not to experimental artifacts or contaminating activities.

How does the DsbB protein from Alcanivorax borkumensis compare structurally and functionally to homologs from other bacteria?

Structural comparisons would require high-resolution structural data from both proteins, which could be obtained through NMR spectroscopy approaches as outlined for E. coli DsbB. The methodology involves extensive isotopic labeling, collection of various structural constraints (NOEs, RDCs, PREs), and a hybrid structure calculation approach.

Functionally, comparative enzymatic assays examining:

  • Substrate specificity profiles

  • Catalytic efficiency parameters (kcat/KM)

  • Stability under various conditions (temperature, pH, salt)

  • Interactions with partner proteins

would reveal adaptations specific to A. borkumensis' marine, hydrocarbon-degrading lifestyle.

The most informative comparison would involve complementation studies, where A. borkumensis DsbB is expressed in E. coli dsbB mutants to assess functional conservation, followed by detailed biochemical characterization of both proteins under identical conditions.

What is the role of DsbB in the hydrocarbon degradation pathways of Alcanivorax borkumensis?

A. borkumensis utilizes multiple enzyme systems for converting alkanes to fatty acids through terminal oxidation. These systems include enzymes encoded by the alkB1 gene and other pathways specific to hydrocarbon metabolism. Many of these extracytoplasmic proteins likely require disulfide bonds for proper folding and function.

DsbB would contribute indirectly to hydrocarbon degradation by:

  • Maintaining DsbA in its oxidized, active state

  • Enabling proper disulfide bond formation in key proteins of the alkane degradation pathways

  • Supporting the structural integrity of membrane proteins involved in hydrocarbon uptake

  • Potentially participating in redox balance mechanisms unique to hydrocarbon metabolism

Experimental approaches to test this would include:

  • Construction of dsbB knockout mutants and assessment of hydrocarbon degradation efficiency

  • Proteomic analysis of disulfide-bonded proteins in wild-type versus dsbB mutants during growth on hydrocarbons

  • Identification of specific hydrocarbon degradation enzymes that contain disulfide bonds and may be DsbB-dependent

What are the key differences in the catalytic mechanism of DsbB compared to other disulfide bond formation proteins?

DsbB employs a unique catalytic mechanism compared to other disulfide bond formation proteins. Based on structural and functional studies of DsbB proteins:

  • Membrane-embedded operation: Unlike soluble disulfide isomerases, DsbB functions within the membrane environment, which influences its redox properties and accessibility.

  • Quinone-coupled electron transfer: DsbB transfers electrons from reduced DsbA to ubiquinone or menaquinone in the electron transport chain, linking protein disulfide bond formation directly to cellular respiration. This contrasts with other systems that may use different electron acceptors.

  • Concerted cysteine cooperation: The cysteines in DsbB work in a highly coordinated manner to facilitate electron transfer. NMR studies have revealed that these cysteines cooperate in a concerted reaction to move electrons from DsbA to quinones.

  • Structural transitions: DsbB undergoes significant conformational changes during its catalytic cycle, with the position and reactivity of cysteines being modulated through these structural shifts.

  • Vertical electron pathways: Unlike horizontal electron transfer in many enzymes, DsbB facilitates vertical electron movement across the membrane, connecting periplasmic disulfide formation with cytoplasmic electron transport chains.

The detailed mechanistic understanding comes from advanced structural studies using NMR and complementary biochemical approaches that have mapped the electron flow through the protein's redox-active centers.

How should researchers analyze NMR data for membrane proteins like DsbB?

Analyzing NMR data for membrane proteins like DsbB requires specialized approaches due to their challenging nature. Researchers should follow this methodological framework:

  • Spectral quality assessment:

    • Evaluate signal-to-noise ratios and line widths

    • Identify regions of spectral overlap or missing assignments

    • Validate sample stability throughout data collection

  • Sequential assignment strategy:

    • Begin with backbone assignment using triple-resonance experiments

    • Employ selective labeling schemes to resolve ambiguities

    • Use TROSY-based experiments to improve resolution

  • Secondary structure determination:

    • Analyze chemical shift indices

    • Identify medium-range NOE patterns

    • Validate with residual dipolar couplings

  • Tertiary structure calculation using a hybrid approach:

    • First determine structure of individual secondary structure elements

    • Fix these elements using hydrogen bond restraints and torsion angle restraints

    • Fold segments together using various constraints

  • Structural validation:

    • Ramachandran analysis

    • NOE violations assessment

    • Cross-validation with unassigned data

  • Integration with complementary data:

    • Paramagnetic relaxation enhancement for long-range constraints

    • Residual dipolar couplings for orientation information

    • Functional data to validate structural models

This methodological approach has proven effective for determining high-resolution structures of challenging membrane proteins like DsbB.

What are the key experimental constraints used in determining DsbB structure and their relative contributions?

The determination of DsbB structure relies on multiple types of experimental constraints, each providing unique and complementary structural information. The following table summarizes these constraints and their contributions based on NMR studies:

Constraint TypeNumber of Constraints (DsbB[CSSC])Number of Constraints (DsbB[CSSC]-UQ2)Structural Information Provided
NOE Distance Constraints
Intra-residue4144Local geometry
Sequential191191Secondary structure
Medium-range216216Helical packing
Long-range3939Tertiary fold
IntermolecularNA10Ligand binding
Ambiguous1414Additional restraints
Hydrogen bonds9797Secondary structure stabilization
PRE Constraints
Upper bound871872Long-range distance information
Lower bound273274Distance exclusions
Dihedral Angles
φ144144Backbone conformation
ψ151151Backbone conformation

The most critical constraints for membrane protein structure determination are:

  • PRE constraints, which provide essential long-range information

  • RDCs, which help orient secondary structure elements

  • Dihedral angles, which define the backbone conformation

  • Long-range NOEs, which establish tertiary contacts

The hybrid approach to structure calculation leverages these complementary constraints to overcome the limitations inherent to membrane protein NMR studies.

How can researchers interpret contradictory experimental results when studying DsbB function?

When researchers encounter contradictory experimental results when studying DsbB function, a systematic troubleshooting and interpretation framework should be employed:

  • Identify the nature of contradiction:

    • Kinetic parameters discrepancies

    • Structural inconsistencies

    • Functional assay conflicts

    • Phenotypic observation differences

  • Methodological reconciliation:

    • Compare experimental conditions (pH, temperature, buffers, detergents)

    • Evaluate protein preparation methods (expression system, purification approach)

    • Assess assay sensitivities and limitations

    • Consider time-dependent changes in activity or structure

  • Biological explanations:

    • Allosteric regulation or conformational states

    • Post-translational modifications

    • Interaction with different partners or lipids

    • Species-specific adaptations

  • Technical resolution strategies:

    • Employ orthogonal techniques to validate findings

    • Design experiments that directly address the contradiction

    • Perform concentration or condition-dependent studies

    • Utilize mutagenesis to test mechanistic hypotheses

  • Integration of disparate results:

    • Develop models that accommodate seemingly contradictory data

    • Consider kinetic or thermodynamic transitions between states

    • Evaluate the biological relevance of in vitro versus in vivo observations

This methodological approach enables researchers to transform contradictions into deeper mechanistic insights about DsbB function and its biological roles.

What are promising approaches for studying the in vivo function of DsbB in Alcanivorax borkumensis?

To study the in vivo function of DsbB in A. borkumensis, several promising methodological approaches should be considered:

  • Genetic manipulation systems:

    • Develop CRISPR-Cas9 or homologous recombination techniques for A. borkumensis

    • Create conditional knockout strains using inducible promoters

    • Implement complementation systems with tagged variants

  • In situ activity assays:

    • Design fluorescent reporters for disulfide bond formation

    • Develop metabolic labeling approaches for newly synthesized proteins

    • Employ click-chemistry for tracking DsbB-dependent processes

  • Physiological characterization:

    • Compare growth kinetics on different hydrocarbon substrates between wild-type and dsbB mutants

    • Analyze biofilm formation and cell envelope integrity

    • Assess stress responses (oxidative, membrane, temperature) in presence/absence of functional DsbB

  • Proteomic profiling:

    • Identify the disulfide proteome using diagonal gel electrophoresis

    • Compare redox states of periplasmic proteins in wild-type versus dsbB mutants

    • Quantify changes in hydrocarbon metabolism pathways

  • Environmental relevance studies:

    • Simulate oil spill conditions in laboratory microcosms

    • Compare competitiveness of wild-type versus dsbB mutants in mixed communities

    • Assess hydrocarbon degradation efficiency under realistic environmental conditions

These approaches would provide comprehensive insights into the biological roles of DsbB in A. borkumensis and its contribution to this organism's unique ecological niche.

How might understanding DsbB function in Alcanivorax borkumensis contribute to bioremediation applications?

Understanding DsbB function in A. borkumensis could significantly advance bioremediation applications through several mechanistic pathways:

  • Enhanced hydrocarbon degradation efficiency:

    • If DsbB supports proper folding of key alkane degradation enzymes, optimizing its function could enhance the organism's degradative capacity

    • Engineering DsbB or the disulfide bond formation pathway could potentially improve the stability and activity of hydrocarbon-degrading enzymes

  • Improved environmental adaptation:

    • Understanding how DsbB contributes to stress tolerance might allow development of A. borkumensis strains with enhanced survival in challenging environmental conditions

    • Identifying DsbB-dependent pathways could inform strategies to improve performance in various oil spill scenarios (temperature, salinity, contaminant mixtures)

  • Biosensor development:

    • DsbB-dependent proteins involved in hydrocarbon sensing could be exploited to develop biosensors for detecting oil contamination

    • Understanding the disulfide proteome might reveal new biomarkers for monitoring bioremediation progress

  • Synthetic biology applications:

    • Knowledge of DsbB function could inform design of synthetic pathways for enhanced degradation of recalcitrant compounds

    • Engineered disulfide bond formation systems might improve expression of heterologous degradation pathways

  • Community-level interventions:

    • Understanding how DsbB contributes to A. borkumensis' competitive success could inform strategies to enhance its abundance in contaminated environments

    • DsbB-mediated adaptations might reveal principles for designing microbial consortia with improved remediation capabilities

These applications highlight the translational potential of fundamental research on DsbB function in this environmentally significant organism.

What are the most significant technical challenges in studying membrane proteins like DsbB, and what emerging technologies might address them?

Studying membrane proteins like DsbB presents significant technical challenges that require innovative approaches:

  • Expression and purification limitations:

    • Challenge: Low expression yields and aggregation during purification

    • Emerging solutions: Cell-free expression systems, novel fusion partners, nanodiscs, and automated high-throughput purification platforms

  • Structural determination difficulties:

    • Challenge: Size limitations for NMR, crystallization challenges for X-ray

    • Emerging solutions: Cryo-electron microscopy advancements for smaller proteins, integrative structural biology approaches combining multiple techniques, AI-assisted structure prediction

  • Functional reconstitution complexities:

    • Challenge: Maintaining native-like activity in artificial environments

    • Emerging solutions: Lipid nanodiscs with controlled composition, droplet interface bilayers, microfluidic platforms for single-molecule studies

  • In vivo tracking limitations:

    • Challenge: Visualizing membrane protein dynamics in native environments

    • Emerging solutions: Super-resolution microscopy techniques, genetically encoded sensors for redox states, advanced fluorescent protein engineering

  • Computational modeling constraints:

    • Challenge: Accurately simulating membrane protein dynamics

    • Emerging solutions: Enhanced molecular dynamics with specialized force fields, quantum mechanics/molecular mechanics approaches, machine learning integration

The field is rapidly evolving with new technologies addressing these challenges. Particularly promising are advancements in native mass spectrometry for membrane proteins, hydrogen-deuterium exchange mass spectrometry for conformational dynamics, and integrated computational-experimental pipelines that can handle the complexity of membrane protein systems like DsbB.

What are the key takeaways for researchers beginning work with Alcanivorax borkumensis DsbB?

Researchers beginning work with A. borkumensis DsbB should consider these essential methodological principles:

  • Experimental design must account for the membrane-bound nature of DsbB, requiring careful consideration of detergent selection and protein stability.

  • A multidisciplinary approach combining genetic, biochemical, and structural techniques will yield the most comprehensive understanding of DsbB function.

  • Comparative studies with better-characterized DsbB proteins (such as from E. coli) provide valuable context but should acknowledge potential adaptations specific to A. borkumensis' unique ecological niche.

  • Technical challenges in membrane protein research necessitate rigorous controls and validation using complementary techniques.

  • The biological significance of DsbB extends beyond its biochemical function to its role in supporting A. borkumensis' remarkable hydrocarbon degradation capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.