Recombinant Alcanivorax borkumensis Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview of MsbA in Alcanivorax borkumensis

MsbA (UniProt ID: Q0VQP5) is an ATP-binding cassette (ABC) transporter essential for lipid A export in Alcanivorax borkumensis, a marine hydrocarbon-degrading bacterium. It facilitates the translocation of Lipid A (a precursor of lipopolysaccharides) across the inner membrane, a critical step in outer membrane biogenesis. The recombinant protein is engineered with an N-terminal His-tag for purification and functional studies.

PropertyDetail
Gene NamemsbA
Protein LengthFull-length (1–582 aa)
Expression HostEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles
Source:

2.2. Mechanism of Action

MsbA undergoes a substrate-dependent ATP hydrolysis cycle:

  1. ATP Binding: NBDs dimerize, inducing TMD closure.

  2. Lipid A Binding: Hexaacylated lipid A activates ATPase activity (4–5× stimulation).

  3. ATP Hydrolysis: Translocates lipid A to the outer leaflet.

  4. ADP Release: NBDs dissociate, resetting the transporter.

ATPase Activity Parameters

ParameterValue (With Lipid A)Value (Without Lipid A)
K<sub>m</sub> (ATP)379 μM878 μM
V<sub>max</sub>154 nmol/min/mg37 nmol/min/mg
Source:

3.1. Lipid Export and Metabolic Adaptations

  • Lipid Export Defects: Mutants lacking MsbA in Alcanivorax species fail to secrete lipids (triacylglycerols, wax esters) despite intracellular synthesis, confirming its role in extracellular lipid trafficking .

  • Proteomic Analysis: Alkane-grown A. borkumensis upregulates membrane proteins involved in alkane oxidation, suggesting MsbA interacts with fatty acid metabolism .

4.1. Industrial Biotechnology

  • Lipid Production: A. borkumensis is used in bioremediation; MsbA’s role in lipid export could enhance biofuel production by optimizing extracellular lipid yield .

  • Protein Engineering: Recombinant MsbA serves as a model for studying ABC transporter mechanisms, aiding inhibitor design (e.g., antibacterial agents targeting lipid A biosynthesis) .

4.2. Research Tools

  • Structural Studies: Recombinant MsbA is used in cryo-EM and functional assays to elucidate ABC transporter dynamics .

  • Biochemical Assays: ATPase activity measurements validate substrate specificity and conformational states .

Challenges and Future Directions

  • Conformational Trapping: Detergents and nanodiscs alter MsbA’s native dynamics; optimizing membrane mimetics for functional studies remains critical .

  • Species-Specific Adaptations: Comparative studies of Alcanivorax MsbA with E. coli orthologs could reveal lipid transport specialization in hydrocarbonoclastic bacteria .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; ABO_1055; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
msbA
Target Protein Sequence
MSQPIPPEDVWPTYKRLLSYVRPYWFMLVISVIGYALYAGAQAGAAQLAGYLGDTIVNPT DARVLIVSIAPLVLVLFQGLGQFMGSYSMNWVAQQIVYVLRNDVFEHVLKLPQSEYHRNA SGRIMSKIIFDAQQVTSAGTDAIIVIIREGLTVIGLFSFLLWQNWKLTLILVTVVPLIAL VMNITSKRFRKISRRIQSSMANITHFLGEAIEGSGEVKIFGGQAQEADRFHNVSRSFAKQ NVKLNASKIASTVIVQLFVAVGIGFITYLYIHLMGEDLTVGGFLSYITAAGMIQKPLKQL TDVNVKVQRGVTGAASLFELLDTEQETDTGTYTVATKVDGNIDFEGVSFGYDPASPVVRQ LNFAIKAGETVALVGRSGAGKSTISAMLPRFFDPDQGRILLDGIPLQEYQLSELRNQIAM VSQRVVLFNDSVRNNIAYGELRSSDDASIIKAAKDAHAWSFIEQLEHGLDTLLGQDGVQL SGGQRQRIAIARALLKDAPVLILDEATSALDSESEHHIQQALEQVMQGRTTLVIAHRLST IEKADRIMVLDQGQLIEQGSHQQLLEKNGLYTQMYRMNFSEE
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MsbA in Alcanivorax borkumensis?

MsbA in A. borkumensis, like its homologs in other Gram-negative bacteria, functions as an essential ATP-binding cassette (ABC) transporter that mediates the transport of lipid A, the hydrophobic anchor of lipopolysaccharide (LPS), from the cytoplasmic membrane to the outer membrane . This transport is crucial for the proper formation and maintenance of the outer membrane, which serves as a protective barrier for the bacterium. MsbA was initially identified as a membrane-bound ATPase involved in lipid A export, and depletion or loss of function of this protein is lethal for the bacterium .

In the context of A. borkumensis specifically, which exhibits a highly restricted growth substrate profile specialized for petroleum hydrocarbon degradation, MsbA likely plays an important role in supporting the bacterium's unique physiological adaptations for alkane metabolism . While the search results don't directly link MsbA to hydrocarbon degradation pathways, its essential role in membrane biogenesis indirectly supports the bacterium's specialized metabolic capabilities.

How does the structure of MsbA enable its lipid A transport function?

The structure of MsbA consists of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs), forming a homodimer. Recent cryo-EM studies have revealed that MsbA can accommodate an entire LPS molecule between its TMDs . The structural basis for LPS recognition and transport involves several key features:

  • A ring of hydrophilic interactions formed by specific residues (Arg78, Arg148, Gln256, Arg296, and Lys299) that interact with the phosphate groups and glucosamines of lipid A .

  • These LPS-interacting residues are organized into two groups, each forming a cluster of positive charges that interacts with either the 1-PO₄ or 4'-PO₄ group of lipid A .

  • The bound LPS bridges the two TMDs, which restricts TMD opening and stabilizes a more closed inward-facing conformation .

  • During the transport cycle, conformational changes in MsbA rearrange the TM helices, creating a pathway for LPS flipping and eventual release to the outer leaflet of the membrane .

The structure of MsbA in different nucleotide states (nucleotide-free, ADP-bound, and vanadate-trapped) has provided crucial insights into the conformational changes that drive lipid A transport .

What is the relationship between A. borkumensis MsbA and the bacterium's oil-degrading capabilities?

A. borkumensis is a ubiquitous marine petroleum oil-degrading bacterium that can dramatically increase in numbers after an oil spill and become the most abundant microbe in oil-polluted waters . While the search results don't directly establish a mechanistic link between MsbA and oil degradation pathways, several indirect connections can be inferred:

What is the molecular mechanism of the "trap-and-flip" model for MsbA-mediated LPS transport?

Cryo-EM structures have revealed a detailed "trap-and-flip" model for MsbA-mediated LPS transport, which can be described in six steps grouped into three nucleotide states :

ADP or nucleotide-free state:

  • MsbA in the inward-facing conformation opens its TMDs to allow LPS entry from the cytoplasmic leaflet.

  • Stably bound LPS restricts TMD opening and aligns NBDs for ATP binding.

ATP state:
3. Conformational changes in MsbA abolish LPS binding.
4. These changes facilitate the movement of LPS acyl chains into the periplasmic leaflet.

ATP transition state:
5. All TM helices form a compact bundle after LPS release.
6. Upon γ-phosphate release, MsbA returns to the inward-facing conformation.

This model is distinct from other lipid flipping mechanisms, such as the "credit card model" proposed for P4-ATPase flippases and TMEM16 scramblase, where the hydrophobic acyl chains remain in the membrane during flipping .

The structural evidence supporting this model shows that the bound LPS has its acyl chains reaching the level of the periplasmic leaflet and has almost completed its transbilayer movement, albeit without flipping . The transition from the inward-facing to outward-facing conformation, which occurs upon ATP binding, involves a reorganization of the TM helices that likely promotes LPS flipping by:

  • Creating a crevice between TM1 and TM3

  • Breaking the positively charged clusters surrounding the glucosamines of LPS

  • Opening the hydrophobic pocket to expose the acyl chains of LPS to the hydrophilic periplasm

How do specific amino acid residues contribute to MsbA's interaction with lipid A?

Cryo-EM structures have identified several key amino acid residues in MsbA that form specific interactions with lipid A :

ResidueLocationInteraction with Lipid A
Arg78TM2Forms hydrophilic interactions with phosphate groups and glucosamines
Arg148TM3Forms hydrophilic interactions with phosphate groups and glucosamines
Gln256TM5Forms hydrophilic interactions with phosphate groups and glucosamines
Arg296TM6Forms hydrophilic interactions with phosphate groups and glucosamines
Lys299TM6Forms hydrophilic interactions with phosphate groups and glucosamines

These residues are highly conserved across MsbA homologs, indicating their functional importance . Experimental evidence supporting their critical role in lipid A binding includes:

  • Mass spectrometry analysis showing that wild-type MsbA co-purifies with LPS, while a R78A/R148A/K299A triple mutant does not .

  • ATPase activity assays demonstrating that wild-type MsbA shows approximately 2.5-fold stimulation by Kdo2-lipid A, whereas the triple mutant shows no stimulation .

These residues form two distinct clusters of positive charges, each localized within one TMD (except for Arg296 and Lys299, which are on the same TM6 but interact with different phosphate groups) . This arrangement allows bound LPS to bridge the two TMDs, which likely restricts TMD opening and stabilizes a more closed inward-facing conformation .

What is the evidence for MsbA's dual role in lipid A transport and drug efflux?

Several lines of evidence support MsbA's dual functionality in both lipid A transport and drug efflux:

  • Functional expression of E. coli MsbA in Lactococcus lactis (which lacks LPS) conferred an 86-fold increase in resistance to the macrolide erythromycin, indicating its ability to transport this antibiotic .

  • Kinetic characterization of MsbA-mediated transport of fluorescent substrates (ethidium and Hoechst 33342) revealed apparent single-site kinetics and competitive inhibition by vinblastine with Ki values of 16 and 11 μM, respectively .

  • Free lipid A noncompetitively inhibits Hoechst 33342 transport with a Ki of 57 μM, suggesting that lipid A and drugs can bind simultaneously to different sites on MsbA .

  • MsbA shows homology to LmrA, a multidrug transporter in Lactococcus lactis, supporting its potential role in drug transport .

  • These observations demonstrate the ability of heterologously expressed MsbA to interact with both free lipid A and multiple drugs in the absence of auxiliary proteins from the original host organism .

This dual functionality may provide A. borkumensis with adaptability in oil-contaminated environments, potentially contributing to resistance against toxic compounds encountered in such settings, although this specific ecological advantage is not directly addressed in the search results.

What expression systems and purification strategies are optimal for recombinant A. borkumensis MsbA studies?

Although the search results don't specifically detail expression and purification methods for A. borkumensis MsbA, several approaches used for MsbA from other bacteria can be applied:

  • Heterologous expression systems:

    • Expression in Lactococcus lactis has proven successful for E. coli MsbA, providing a system free of endogenous LPS for studying drug transport functions .

    • E. coli expression systems optimized for membrane proteins (C41/C43 strains) could be suitable for structural and functional studies.

  • Purification approaches:

    • Affinity purification using engineered tags, followed by additional chromatography steps to ensure homogeneity.

    • Careful selection of detergents is critical for maintaining MsbA structure and function during solubilization and purification.

    • For cryo-EM studies, purification approaches that preserve native lipid interactions may be beneficial, as demonstrated by the co-purification of LPS with wild-type MsbA .

  • Functional verification:

    • ATPase activity assays with and without lipid A stimulation can verify the functionality of purified protein .

    • Mass spectrometry analysis can confirm co-purification with native lipid A, indicating proper folding and substrate binding capability .

    • Fluorescent labeling, such as with MIANS on specific cysteine residues, can be used to probe conformational states .

  • Reconstitution systems:

    • Proteoliposomes for functional assays of transport activity .

    • Nanodiscs or amphipols for structural studies in a more native-like membrane environment.

Each approach should be optimized specifically for A. borkumensis MsbA, taking into account its potential unique properties related to the bacterium's specialized metabolism.

How can site-directed mutagenesis be utilized to probe structure-function relationships in A. borkumensis MsbA?

Site-directed mutagenesis represents a powerful approach for investigating MsbA's structure-function relationships. Based on the search results, the following strategies would be particularly informative:

  • Targeting conserved residues involved in lipid A binding:

    • Mutation of Arg78, Arg148, and Lys299 to alanine abolished LPS binding and LPS-stimulated ATPase activity in E. coli MsbA .

    • Creating equivalent mutations in A. borkumensis MsbA would confirm conservation of the lipid A binding mechanism.

    • Additional mutations of residues Gln256 and Arg296 could further probe the interaction network with lipid A .

  • Investigating the conformational cycle:

    • Mutations at the NBD-TMD interface could reveal how conformational changes are transmitted during the transport cycle.

    • Introduction of disulfide bonds or crosslinks at strategic positions could trap specific conformational states for structural analysis.

  • Probing substrate specificity:

    • If A. borkumensis MsbA exhibits unique substrate preferences related to the bacterium's specialized metabolism, mutations in the substrate-binding pocket could identify determinants of this specificity.

    • Creating chimeric proteins with MsbA from other bacteria might reveal domains responsible for any A. borkumensis-specific properties.

  • Functional analysis of mutants:

    • ATPase activity assays with and without lipid A stimulation .

    • Mass spectrometry to detect co-purification with LPS .

    • Transport assays using fluorescent substrates like ethidium and Hoechst 33342 .

    • Complementation studies in MsbA-depleted cells to assess in vivo function.

  • Cysteine scanning and fluorescent labeling:

    • Introduction of cysteine residues at specific positions for labeling with fluorescent probes like MIANS .

    • This approach can provide insights into conformational changes and solvent accessibility during the transport cycle.

Each mutation should be analyzed using multiple complementary approaches to build a comprehensive understanding of structure-function relationships.

What structural biology techniques are most effective for characterizing A. borkumensis MsbA?

Several structural biology techniques have proven valuable for studying MsbA and would be applicable to A. borkumensis MsbA:

  • Cryo-electron microscopy (cryo-EM):

    • This technique successfully revealed the structure of E. coli MsbA with bound LPS, including detailed interactions between the protein and substrate .

    • Cryo-EM is particularly suitable for membrane proteins and can capture different conformational states.

    • For A. borkumensis MsbA, cryo-EM could reveal any unique structural features related to the bacterium's specialized physiology.

  • X-ray crystallography:

    • Crystal structures of MsbA from other bacteria (e.g., Salmonella, E. coli) have provided valuable insights into conformational states associated with different nucleotides .

    • While challenging for membrane proteins, this approach could provide high-resolution details of specific domains or conformational states.

  • Model building and refinement:

    • Initial models based on homologous structures can be refined against experimental data using tools like UCSF Chimera, Coot, and phenix.real_space_refine .

    • For A. borkumensis MsbA, this approach would be particularly useful if high-resolution experimental data is limited.

  • Molecular dynamics simulations:

    • Computational simulations can provide insights into dynamic aspects of the transport cycle that may not be captured by static structures.

    • These have been useful for related transporters to understand the degree of TMD opening during substrate release .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • This technique can provide information about protein dynamics and conformational changes in solution.

    • It would be particularly valuable for studying the conformational cycle of A. borkumensis MsbA during transport.

  • Single-particle tracking and fluorescence techniques:

    • For functional studies complementing structural analysis, these approaches can reveal real-time dynamics of the transport process.

A multi-technique approach combining these methods would provide the most comprehensive structural characterization of A. borkumensis MsbA.

How can the ATPase activity and transport function of A. borkumensis MsbA be effectively measured?

Based on approaches described in the search results, several complementary methods can be employed to assess MsbA function:

  • ATPase activity assays:

    • Measure ATP hydrolysis by purified MsbA reconstituted in proteoliposomes .

    • Compare basal activity versus stimulation by lipid A substrates (e.g., Kdo2-lipid A shown to stimulate E. coli MsbA ~2.5-fold) .

    • Analyze how mutations affect both basal activity and substrate stimulation.

  • Lipid A binding assays:

    • Mass spectrometry analysis to detect co-purification of LPS with MsbA .

    • Surface plasmon resonance or isothermal titration calorimetry to determine binding affinities.

    • Fluorescence-based binding assays using labeled lipid A analogs.

  • Transport assays with fluorescent substrates:

    • Measure transport of fluorescent compounds like ethidium and Hoechst 33342 .

    • Perform kinetic characterization to determine transport parameters (Km, Vmax).

    • Assess competitive inhibition between different substrates to probe binding site interactions .

  • Inhibition studies:

    • Use competitive inhibitors like vinblastine to probe drug binding sites .

    • Examine noncompetitive inhibition by free lipid A to understand allosteric regulation .

    • These studies can reveal mechanistic details of substrate recognition and transport.

  • In vivo complementation assays:

    • Test whether A. borkumensis MsbA can complement MsbA-depleted E. coli cells.

    • Measure resistance to specific drugs when A. borkumensis MsbA is expressed in a heterologous host .

  • Fluorescent labeling to track conformational changes:

    • Label purified MsbA with fluorescent probes like MIANS at specific cysteine residues .

    • Monitor conformational changes in response to substrate binding and ATP hydrolysis.

These complementary approaches would provide a comprehensive functional characterization of A. borkumensis MsbA, enabling comparisons with homologs from other bacteria and revealing any unique properties related to the bacterium's specialized physiology.

How might studying A. borkumensis MsbA contribute to bioremediation technologies for oil spills?

Understanding A. borkumensis MsbA could contribute to bioremediation technologies in several ways:

  • Enhanced bacterial survival in contaminated environments:

    • A. borkumensis can dramatically increase in numbers after an oil spill and become the most abundant microbe in oil-polluted waters .

    • Understanding how MsbA contributes to membrane integrity and potentially to resistance against toxic compounds could lead to strategies for improving bacterial survival and activity in heavily contaminated environments.

  • Metabolic engineering for improved bioremediation:

    • If MsbA influences the bacterium's ability to adapt to growth on hydrocarbons, manipulating its expression or activity might enhance the bacterium's oil-degrading capabilities.

    • The proteomic differences observed between hexadecane-grown and pyruvate-grown cells suggest coordinated metabolic adaptations that might be optimized for bioremediation applications.

  • Storage lipid metabolism:

    • A. borkumensis accumulates storage lipids as an adaptation mechanism for coping with nutrient limitation .

    • Understanding how membrane transport systems like MsbA interact with the bacterium's storage lipid metabolism could provide insights for optimizing bacterial survival during bioremediation processes.

  • Resistance to toxic compounds:

    • MsbA's potential role in drug efflux might contribute to the bacterium's ability to tolerate toxic components in crude oil.

    • Enhanced understanding of these resistance mechanisms could lead to strategies for improving bacterial survival in heavily contaminated environments.

  • Biotechnological applications beyond bioremediation:

    • The detailed structural and functional understanding of MsbA could inform the design of biomimetic transport systems for various biotechnological applications.

    • Insights into lipid transport mechanisms could be applied to engineered systems for lipid extraction or processing in industrial contexts.

Further research specifically linking MsbA function to the bacterium's oil-degrading capabilities would strengthen these potential applications.

What are the unique challenges in studying A. borkumensis MsbA compared to homologs from other bacteria?

Studying A. borkumensis MsbA presents several unique challenges that researchers should consider:

  • Specialized growth requirements:

    • A. borkumensis has a highly restricted growth substrate profile, primarily growing on petroleum hydrocarbons plus a few organic acids .

    • These specialized growth requirements make cultivation and genetic manipulation more challenging than for model organisms like E. coli.

  • Essential nature of MsbA:

    • As MsbA is essential for cell viability , complete knockout mutants would be lethal, complicating genetic studies.

    • Previous transposon mutagenesis experiments with A. borkumensis yielded only mutants with defects in downstream metabolic steps rather than in the primary alkane oxidation systems , suggesting functional redundancy that complicates genetic analysis.

  • Specialized membrane composition:

    • A. borkumensis likely has a specialized membrane composition adapted to its hydrocarbonoclastic lifestyle, which might influence MsbA function.

    • Storage lipid accumulation has been observed as an adaptation mechanism , potentially affecting membrane properties.

  • Multiple alkane degradation systems:

    • Evidence suggests A. borkumensis has multiple systems for alkane degradation , creating a complex metabolic background for studying any individual component.

    • Untangling the specific contribution of MsbA to the bacterium's specialized physiology requires careful experimental design.

  • Structural analysis challenges:

    • If A. borkumensis MsbA has unique structural features related to the bacterium's specialized metabolism, these might not be apparent from homology models based on E. coli or Salmonella MsbA.

    • Structural studies would need to capture any such unique features, potentially requiring specialized approaches.

  • Functional redundancy:

    • If A. borkumensis has multiple lipid A transport systems, as suggested by the redundancy in alkane oxidation systems , this could complicate functional analysis of MsbA specifically.

Addressing these challenges will require a combination of approaches, including heterologous expression systems, conditional mutants, and comparative studies with MsbA homologs from other bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.