Recombinant Alcanivorax borkumensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; ABO_2434; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
mtgA
Target Protein Sequence
MTFRRRLLQFLALLFVVATLAQLWYLGQVLRLQHHNPDSSAYMHRAQKQGNVQQDWRDYD QISDYLKRAVLISEDAHFTQHTGFDWEGIRYALKRNMEAGKPVAGGSTITQQLAKNLYLS GERTYTRKAQEAVIALMLEIGLSKRRILELYLNVAQWGHQIYGAEAAAQHYFQISAAQLS PLQAAQLAAMLPRPNLYDFKGPTDYVQQRASWIQAQMALVRIPDPGTVPLPPPPEPTAPP EGNTQ
Uniprot No.

Target Background

Function

Function: Recombinant Alcanivorax borkumensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of mtgA in Alcanivorax borkumensis cell wall synthesis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) plays a crucial role in peptidoglycan biosynthesis in Alcanivorax borkumensis. This 26.5 kDa enzyme is predicted to be associated with the inner membrane and catalyzes the polymerization of lipid II into nascent glycan strands during cell wall formation . As a transglycosylase, mtgA forms β-1,4-glycosidic bonds between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) residues, which is essential for maintaining cell wall integrity. In A. borkumensis, mtgA has been observed to be selectively enriched (>10-fold) in mitomycin C (MMC)-induced membrane vesicles (MVs), suggesting its potential involvement in stress response mechanisms .

How does mtgA expression in A. borkumensis differ depending on growth conditions?

The expression of mtgA in A. borkumensis varies significantly based on growth conditions and carbon sources. When A. borkumensis is grown on hydrocarbon substrates like n-dodecane (C12), the expression pattern of peptidoglycan biosynthesis genes, including mtgA, differs from growth on non-hydrocarbon substrates like pyruvate . This differential expression is likely related to the bacterium's adaptation to utilize hydrocarbons as a carbon source. Research indicates that when exposed to stressors like MMC, mtgA becomes significantly enriched in membrane vesicles (MVs), showing an 11.2-fold increase compared to untreated controls . This suggests that mtgA may have additional functions beyond its primary role in peptidoglycan synthesis, particularly during stress response or when the bacterium is adapting to hydrocarbon metabolism.

What are the structural characteristics of A. borkumensis mtgA compared to homologous enzymes in other bacteria?

A. borkumensis mtgA shares structural similarities with other bacterial transglycosylases while possessing unique features that may be adapted to its marine hydrocarbon-degrading lifestyle. The enzyme contains conserved catalytic domains typical of peptidoglycan glycosyltransferases, including glycosyltransferase domain and transmembrane anchoring regions. While specific crystal structure data for A. borkumensis mtgA is not extensively reported in the provided search results, comparative analysis with homologous enzymes suggests the presence of characteristic structural elements required for peptidoglycan synthesis.

The localization of mtgA to the inner membrane in A. borkumensis is consistent with its function in peptidoglycan biosynthesis, as this positioning enables the enzyme to access lipid II precursors and coordinate with other cell wall synthesis machinery. This membrane association is particularly important in the context of A. borkumensis's adaptation to marine environments and hydrocarbon degradation, where cell wall integrity must be maintained under potentially stressful conditions.

What are the optimal conditions for recombinant expression of A. borkumensis mtgA?

For optimal recombinant expression of A. borkumensis mtgA, several key parameters must be considered:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains are recommended for initial expression trials

  • For membrane proteins like mtgA, specialized strains such as C41(DE3) or C43(DE3) may provide better yields

  • Consider codon optimization based on A. borkumensis codon usage patterns

Vector and Tag Selection:

  • pET vectors with N-terminal or C-terminal His6-tag facilitate purification

  • For improved solubility, fusion partners such as MBP (maltose-binding protein) or SUMO may be beneficial

  • Include a TEV or PreScission protease cleavage site for tag removal

Expression Conditions:

  • Induction at lower temperatures (16-20°C) often improves folding of membrane-associated proteins

  • IPTG concentration optimization (typically 0.1-0.5 mM)

  • Extended expression time (16-24 hours) at reduced temperatures

  • Supplementation with 0.5-1% glucose to reduce basal expression

Cell Lysis and Extraction:

  • Gentle detergent extraction using non-ionic detergents (DDM, LDAO)

  • Inclusion of glycerol (10%) to stabilize the protein

  • Addition of protease inhibitors to prevent degradation

When expressing recombinant mtgA, researchers should monitor enrichment patterns similar to those observed in native A. borkumensis, where mtgA shows significant enrichment (11.2-fold) in membrane fractions under certain conditions .

What methods can be used to assess the enzymatic activity of purified recombinant mtgA?

Several complementary approaches can be employed to assess the enzymatic activity of purified recombinant A. borkumensis mtgA:

1. Radiolabeled Substrate Assay:

  • Utilize [14C]-labeled lipid II substrate

  • Monitor incorporation into peptidoglycan polymers

  • Quantify polymerized product by scintillation counting

2. HPLC-Based Analysis:

  • Analyze reaction products using reversed-phase HPLC

  • Detect products using UV absorbance or mass spectrometry

  • Compare with known standards for reaction product identification

3. Fluorescence-Based Assays:

  • Employ dansylated or fluorescently labeled lipid II analogs

  • Monitor fluorescence changes upon polymerization

  • Suitable for high-throughput screening of activity conditions

4. Mass Spectrometry Analysis:

  • Use high-resolution mass spectrometry (HRMS) similar to methods developed for A. borkumensis glycolipid analysis

  • Identify reaction products based on accurate mass and fragmentation patterns

  • Enable precise characterization of enzymatic products

5. Complementation Assays:

  • Express recombinant mtgA in mtgA-deficient bacterial strains

  • Assess restoration of normal growth and cell morphology

  • Evaluate peptidoglycan composition changes

For optimal assessment, reaction conditions should be carefully optimized regarding pH (typically 7.5-8.5), buffer composition (HEPES or Tris-based buffers), divalent cation concentration (Mg2+ or Mn2+, 5-10 mM), and appropriate detergent levels to maintain enzyme solubility while preserving activity.

How can researchers effectively purify recombinant A. borkumensis mtgA while maintaining its activity?

Purification of recombinant A. borkumensis mtgA requires careful consideration of its membrane-associated nature. The following comprehensive protocol is recommended:

Step 1: Membrane Extraction

  • Lyse cells using mechanical disruption (French press or sonication)

  • Separate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilize membranes with appropriate detergents (n-dodecyl-β-D-maltoside at 1% or CHAPS at 0.5-1%)

Step 2: Affinity Chromatography

  • Apply solubilized extract to Ni-NTA or TALON resin

  • Wash extensively with increasing imidazole gradients (10-40 mM)

  • Elute with higher imidazole concentration (250-300 mM)

  • Include detergent at concentrations above CMC in all buffers

Step 3: Size Exclusion Chromatography

  • Further purify using Superdex 200 or similar matrix

  • Use buffer containing reduced detergent concentration (0.05-0.1%)

  • Analyze fractions by SDS-PAGE to identify mtgA-containing fractions

Step 4: Activity Preservation Measures

  • Maintain 10-15% glycerol in all buffers to stabilize the enzyme

  • Include reducing agents (1-5 mM DTT or 2-5 mM β-mercaptoethanol)

  • Store in small aliquots at -80°C with cryoprotectants

Critical Parameters for Activity Retention:

  • Avoid freeze-thaw cycles

  • Maintain pH between 7.5-8.0

  • Include stabilizing agents like glycerol or specific lipids

  • Consider adding substrate analogs for stability enhancement

Researchers should monitor purification efficiency using SDS-PAGE and Western blotting, while assessing enzyme activity at each purification step to ensure the procedure maintains functional integrity.

How does mtgA function in membrane vesicle formation in A. borkumensis compared to other peptidoglycan-modifying enzymes?

The involvement of mtgA in membrane vesicle (MV) formation represents a sophisticated aspect of A. borkumensis cell biology. Research indicates that mtgA is significantly enriched (11.2-fold increase) in MMC-induced MVs compared to untreated controls . This selective enrichment suggests a specialized role for mtgA in MV biogenesis or function.

Comparative Analysis with Other Peptidoglycan-Modifying Enzymes:

EnzymeFold Increase in MVsLocalizationPotential Role in MV Formation
mtgA11.2Inner MembranePeptidoglycan synthesis, potentially creating localized areas of new PG insertion
mltA20.4Outer MembraneLytic transglycosylase activity, potentially creating gaps in PG for MV release
mltF26.6Outer MembraneMay facilitate outer membrane bulging through localized PG degradation
sltB116.1Inner MembraneSoluble lytic transglycosylase, may create controlled PG defects
pbpA17.6Inner MembraneD,D-transpeptidase activity, may regulate PG crosslinking during MV formation
dacB14.1PeriplasmD-alanyl-D-alanine carboxypeptidase, potentially modifying PG crosslinking

While lytic enzymes like mltA and mltF show higher enrichment in MVs, the notable presence of the biosynthetic enzyme mtgA suggests a coordinated remodeling process rather than simple degradation . This indicates that MV formation likely involves precise balance between PG synthesis and hydrolysis.

The distinct enrichment pattern of mtgA compared to other peptidoglycan enzymes suggests it may participate in repairing localized damage or reinforcing the cell wall during stress responses. Furthermore, the presence of both inner membrane-associated (like mtgA) and outer membrane-associated enzymes in MVs indicates a complex, multi-layered process of MV biogenesis involving the entire cell envelope.

What are the mechanisms underlying differential mtgA expression when A. borkumensis is grown on different carbon sources?

The differential expression of mtgA in A. borkumensis when grown on different carbon sources represents a sophisticated adaptive response. When comparing growth on n-dodecane (C12) versus pyruvate, significant changes occur in the expression patterns of cell wall-related genes, including mtgA . This regulation likely involves multiple interconnected mechanisms:

1. Transcriptional Regulation:

  • Hydrocarbon-responsive transcription factors may directly regulate mtgA expression

  • SOS response elements may influence expression during stress conditions

  • Global regulators responding to carbon source availability likely modulate expression levels

2. Post-Transcriptional Control:

  • mRNA stability differences depending on metabolic state

  • Potential small RNA regulation specific to different growth conditions

  • Ribosome binding site accessibility changes based on cellular energy status

3. Metabolic Flux-Dependent Regulation:

  • Different carbon sources alter metabolic flux through peptidoglycan precursor pathways

  • Availability of UDP-N-acetylglucosamine and other precursors influences mtgA activity

  • Cellular energy state (ATP/ADP ratio) affects resources allocated to cell wall synthesis

4. Membrane Composition Effects:

  • Hydrocarbon growth induces changes in membrane lipid composition that may affect mtgA activity

  • Membrane fluidity alterations can influence enzyme localization and function

  • Potential direct interaction between hydrocarbons and membrane-associated enzymes

When A. borkumensis grows on hydrocarbons like n-dodecane, it undergoes significant physiological adaptations, including changes in cell surface properties and membrane structure . These adaptations necessitate coordinated regulation of cell wall synthesis enzymes, including mtgA, to maintain cellular integrity while optimizing hydrocarbon uptake and utilization.

How does the function of mtgA in A. borkumensis relate to the bacterium's ability to produce glycine-glucolipid biosurfactants?

The relationship between mtgA function and biosurfactant production in A. borkumensis represents an intriguing connection between cell wall biosynthesis and hydrocarbon metabolism adaptation. While not directly responsible for biosurfactant synthesis, mtgA's activity may influence this process through several mechanisms:

1. Cell Envelope Integrity and Biosurfactant Export:

  • mtgA ensures proper peptidoglycan synthesis, maintaining cell envelope integrity

  • A functional cell wall is essential for efficient biosurfactant export mechanisms

  • Localized peptidoglycan remodeling may facilitate the creation of specialized export sites

2. Metabolic Coordination:

  • Both peptidoglycan synthesis and glycine-glucolipid biosurfactant production require significant metabolic resources

  • Carbon flux distribution between these pathways may be coordinately regulated

  • Shared precursors or intermediates may exist between these pathways

3. Growth Phase-Dependent Regulation:

  • A. borkumensis produces different amounts of glycine-glucolipid depending on the carbon source (approximately twice as high with hexadecane as with pyruvate - 49 mg/L versus 22 mg/L)

  • Cell wall synthesis requirements also change throughout growth phases

  • Coordinated regulation likely exists to balance these processes

4. Stress Response Integration:

  • Both mtgA activity and biosurfactant production increase during certain stress conditions

  • The presence of hydrocarbons may trigger both increased mtgA expression and biosurfactant synthesis

  • Both processes contribute to maintaining cellular homeostasis under challenging conditions

The biosurfactant profile produced by A. borkumensis varies significantly based on growth conditions, with the main congener (glc-40:0-gly) accounting for 64% with pyruvate and 85% with hexadecane as the sole carbon source . This variation coincides with changes in cell wall metabolism, suggesting coordinated regulation of these processes as part of the bacterium's adaptive strategy for hydrocarbon utilization.

How can recombinant A. borkumensis mtgA be utilized in studying peptidoglycan synthesis inhibitors for antimicrobial development?

Recombinant A. borkumensis mtgA offers significant potential for antimicrobial research, particularly for developing inhibitors of peptidoglycan synthesis. The following methodological approach outlines how researchers can effectively utilize this enzyme:

1. High-Throughput Screening Platform Development:

  • Establish fluorescence-based assays using purified recombinant mtgA

  • Optimize reaction conditions for maximum sensitivity and reproducibility

  • Develop plate-based formats suitable for screening compound libraries

2. Structure-Based Inhibitor Design:

  • Determine crystal structure of recombinant A. borkumensis mtgA

  • Identify active site architecture and potential allosteric sites

  • Conduct in silico docking studies with potential inhibitors

3. Comparative Inhibition Studies:

  • Test known transglycosylase inhibitors (moenomycin, etc.) against recombinant A. borkumensis mtgA

  • Compare inhibition profiles with mtgA enzymes from pathogenic bacteria

  • Identify unique features of A. borkumensis mtgA that could be exploited for selective inhibition

4. Resistance Mechanism Investigation:

  • Generate laboratory-evolved resistant strains

  • Sequence mtgA genes from resistant isolates

  • Characterize mutant enzymes to understand resistance mechanisms

5. Combination Therapy Evaluation:

  • Test synergistic effects between mtgA inhibitors and other antimicrobials

  • Investigate dual-targeting approaches affecting both transglycosylation and transpeptidation

  • Explore potential for reducing emergence of resistance through combination approaches

This approach not only advances our understanding of peptidoglycan synthesis but could lead to novel antimicrobial compounds targeting transglycosylases, addressing the critical need for new antibiotics against resistant bacteria.

What role might mtgA play in the adaptation of A. borkumensis to oil-contaminated marine environments?

In oil-contaminated marine environments, mtgA likely plays a multifaceted role in A. borkumensis adaptation through several mechanisms:

1. Cell Envelope Restructuring for Hydrocarbon Interaction:

  • mtgA-mediated peptidoglycan synthesis may allow specific modifications to cell wall architecture

  • These adaptations could facilitate direct contact with oil droplets

  • Modified cell envelope may protect against hydrocarbon toxicity

2. Coordination with Biosurfactant Production:

  • A. borkumensis produces glycine-glucolipid biosurfactants that enhance attachment to oil droplets and facilitate hydrocarbon uptake

  • mtgA activity may be coordinated with biosurfactant export systems

  • Peptidoglycan remodeling could create specialized domains for biosurfactant secretion

3. Stress Response and Survival:

  • Oil pollution creates multiple stressors (osmotic, oxidative, toxic)

  • mtgA enrichment in membrane vesicles during stress conditions (11.2-fold increase) suggests involvement in stress adaptation

  • Controlled peptidoglycan biosynthesis may be critical for maintaining cellular integrity under these challenging conditions

4. Biofilm Formation on Oil-Water Interfaces:

  • A. borkumensis forms biofilms on hydrocarbon surfaces

  • mtgA likely contributes to the cell wall remodeling necessary for biofilm attachment and maintenance

  • Controlled peptidoglycan synthesis is essential for the cell-to-cell interactions in biofilm matrices

Understanding the specific adaptations of mtgA in A. borkumensis could provide insights into bioremediation strategies and potential biotechnological applications for oil spill cleanup.

How can studying the structure-function relationship of A. borkumensis mtgA contribute to our understanding of peptidoglycan synthesis in extreme environments?

Investigating the structure-function relationship of A. borkumensis mtgA offers unique insights into peptidoglycan synthesis adaptations to extreme environments:

1. Structural Adaptations for Marine Conditions:

  • Analyzing the amino acid composition and structural elements that provide stability in marine environments

  • Identifying salt bridges and hydrophobic interactions that maintain activity in high-salt conditions

  • Comparing with mtgA homologs from non-marine bacteria to identify marine-specific adaptations

2. Substrate Specificity and Catalytic Mechanism:

  • Determining if A. borkumensis mtgA has unique substrate preferences adapted to its ecological niche

  • Investigating whether lipid II precursors have marine-specific modifications

  • Characterizing the kinetic parameters under various salt concentrations and temperatures

3. Protein-Protein Interactions in the Peptidoglycan Synthesis Machinery:

  • Identifying interaction partners of mtgA in A. borkumensis

  • Comparing the multienzyme complexes with those found in model organisms

  • Understanding how these interactions are maintained in extreme conditions

4. Evolutionary Analysis:

  • Conducting phylogenetic analysis of mtgA across diverse bacterial species

  • Identifying potential horizontal gene transfer events that contributed to A. borkumensis adaptation

  • Tracing the evolutionary history of mtgA adaptations to marine hydrocarbon-rich environments

5. Structural Analysis Methods:

  • X-ray crystallography of A. borkumensis mtgA under various conditions

  • Molecular dynamics simulations to understand flexibility and adaptation

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

This research would not only advance our understanding of bacterial adaptation to extreme environments but could also inspire the development of enzymes with enhanced stability for biotechnological applications.

What are the main challenges in expressing and purifying functional recombinant A. borkumensis mtgA, and how can they be addressed?

Researchers face several significant challenges when working with recombinant A. borkumensis mtgA, each requiring specific troubleshooting approaches:

1. Protein Solubility Issues:

ChallengeSolution ApproachSuccess Indicators
Formation of inclusion bodiesLower induction temperature (16°C)Increased protein in soluble fraction
Reduce IPTG concentration (0.1-0.2 mM)Decreased inclusion body formation
Use solubility-enhancing fusion tags (SUMO, MBP)Improved solubility in SDS-PAGE analysis
Add compatible solutes (5-10% glycerol, 1% glucose)Higher yield of soluble protein

2. Membrane Protein Extraction Difficulties:

ChallengeSolution ApproachSuccess Indicators
Inefficient membrane extractionOptimize detergent type and concentrationClear solubilization of target protein
Test multiple detergents (DDM, LDAO, CHAPS)Retention of enzymatic activity
Include lipids during extractionImproved stability during purification
Use specialized membrane protein extraction kitsHigher purity in initial extracts

3. Protein Stability During Purification:

ChallengeSolution ApproachSuccess Indicators
Activity loss during purificationInclude stabilizing agents (glycerol, specific lipids)Retention of activity through purification steps
Maintain constant low temperature (4°C)Minimal degradation bands on SDS-PAGE
Add protease inhibitorsConsistent enzyme activity measurements
Reduce purification time with optimized protocolsHigher final specific activity

4. Low Expression Yields:

ChallengeSolution ApproachSuccess Indicators
Poor expression levelsCodon optimization for expression hostIncreased protein bands on SDS-PAGE
Test multiple expression strainsHigher yield per liter of culture
Optimize growth media compositionImproved cell density and protein expression
Consider auto-induction mediaMore consistent expression results

5. Assay Development Difficulties:

ChallengeSolution ApproachSuccess Indicators
Establishing reliable activity assaysTest multiple substrate preparationsReproducible activity measurements
Optimize reaction conditions (pH, salt, temperature)Linear enzyme kinetics
Develop coupled enzyme assays for higher sensitivityIncreased signal-to-noise ratio
Consider label-free detection methodsConsistent activity across purification batches

By systematically addressing these challenges, researchers can significantly improve the odds of successfully working with recombinant A. borkumensis mtgA while maintaining its native enzymatic properties.

How can researchers distinguish between enzymatic activities of mtgA and other peptidoglycan synthases in complex experimental systems?

Distinguishing the specific activity of mtgA from other peptidoglycan synthases requires meticulous experimental design and selective analytical approaches:

1. Selective Inhibition Approach:

  • Employ moenomycin derivatives with differential specificity for various transglycosylases

  • Use concentration-dependent inhibition profiles to distinguish enzyme contributions

  • Compare inhibition patterns between purified mtgA and complex systems

2. Genetic Manipulation Strategies:

  • Generate conditional mtgA knockout or knockdown strains

  • Create point mutations in catalytic residues specifically altering mtgA activity

  • Perform complementation studies with wild-type or mutated mtgA variants

3. Substrate Modification Approach:

  • Develop fluorescently labeled substrates with specificity for mtgA

  • Use substrate analogs with modified structure that preferentially interact with mtgA

  • Analyze product profiles to distinguish between different enzyme activities

4. Advanced Analytical Techniques:

  • Employ mass spectrometry to identify specific glycan chain modifications characteristic of mtgA

  • Use NMR spectroscopy to analyze subtle structural differences in peptidoglycan products

  • Apply chromatographic separation to distinguish products of different transglycosylases

5. Immunological Detection Methods:

  • Develop specific antibodies against A. borkumensis mtgA

  • Use immunoprecipitation to isolate mtgA-containing complexes

  • Apply activity assays to immunoprecipitated material

6. Recombinant Expression with Differential Tagging:

  • Express mtgA with unique affinity or fluorescent tags

  • Express other peptidoglycan synthases with different tags

  • Use tag-specific detection to monitor individual enzyme contributions

By combining these approaches, researchers can create a comprehensive picture of mtgA activity within complex systems, distinguishing its specific contributions from those of other peptidoglycan-synthesizing enzymes.

What considerations are important when designing experiments to study mtgA involvement in membrane vesicle formation?

Designing experiments to investigate mtgA's role in membrane vesicle (MV) formation requires careful consideration of multiple factors:

1. Induction Conditions and Controls:

  • Compare multiple MV induction methods (MMC, antibiotics, environmental stressors)

  • Include appropriate negative and positive controls for each experimental condition

  • Establish clear baseline measurements of normal MV production

2. Quantitative Analysis of MVs:

  • Implement standardized MV isolation protocols to ensure consistency

  • Use nanoparticle tracking analysis (NTA) for accurate size and concentration measurements

  • Apply electron microscopy to verify MV morphology and integrity

3. Genetic Manipulation Strategies:

  • Generate clean mtgA deletion mutants using allelic exchange

  • Create conditional expression systems for controlled mtgA levels

  • Develop complementation strains with wild-type and mutant variants

4. Protein Localization and Dynamics:

  • Employ fluorescent protein fusions to track mtgA localization during MV formation

  • Use immunogold labeling with electron microscopy for high-resolution localization

  • Apply FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics

5. Biochemical Analysis of MVs:

  • Conduct comprehensive proteomic analysis of MV content

  • Compare protein enrichment patterns between wild-type and mtgA mutant strains

  • Analyze lipid composition and peptidoglycan fragments in isolated MVs

6. Gene Expression Analysis:

  • Monitor expression of mtgA and other peptidoglycan-modifying enzymes during MV formation

  • Use RT-qPCR to quantify transcript levels under different conditions

  • Apply RNA-seq for genome-wide expression changes during MV formation

7. Interaction Studies:

  • Identify potential interaction partners of mtgA using pull-down assays

  • Apply bacterial two-hybrid systems to verify protein-protein interactions

  • Use crosslinking approaches to capture transient interactions during MV formation

8. Functional Assessment:

  • Evaluate the enzymatic activity of mtgA in isolated MVs

  • Compare peptidoglycan composition in MVs from wild-type and mutant strains

  • Assess the impact of mtgA inhibition on MV formation and function

By comprehensively addressing these considerations, researchers can effectively isolate and characterize the specific contribution of mtgA to MV formation in A. borkumensis, particularly in the context of stress responses and adaptation to hydrocarbon-rich environments.

What are the potential biotechnological applications of recombinant A. borkumensis mtgA beyond basic research?

Recombinant A. borkumensis mtgA holds promise for diverse biotechnological applications that extend beyond fundamental research:

1. Bioremediation Enhancement:

  • Engineering bacteria with optimized mtgA expression for improved survival in oil-contaminated environments

  • Developing mtgA-based approaches to enhance bacterial attachment to oil-water interfaces

  • Creating specialized bacterial consortia with modified cell wall properties for efficient hydrocarbon degradation

2. Antimicrobial Development:

  • Using recombinant mtgA as a screening platform for novel transglycosylase inhibitors

  • Developing narrow-spectrum antimicrobials targeting specific bacterial transglycosylases

  • Creating peptidoglycan synthesis inhibitor combinations to reduce resistance development

3. Enzyme-Based Biosensors:

  • Developing mtgA-based biosensors for detecting peptidoglycan synthesis inhibitors

  • Creating environmental monitoring tools for antibiotic contamination

  • Engineering whole-cell biosensors with modified mtgA expression for environmental applications

4. Industrial Enzyme Applications:

  • Exploiting mtgA's stability in harsh conditions for industrial processes

  • Developing enzyme variants with enhanced catalytic efficiency for biocatalysis

  • Creating immobilized enzyme systems for continuous production processes

5. Synthetic Biology Tools:

  • Utilizing mtgA for bacterial cell surface engineering

  • Developing controlled cell lysis systems based on regulated peptidoglycan synthesis

  • Creating tunable systems for bacterial membrane vesicle production

6. Drug Delivery Systems:

  • Engineering bacterial membrane vesicles with modified peptidoglycan composition for pharmaceutical applications

  • Developing targeted delivery systems using engineered cell envelope components

  • Creating stable nanoparticles with modified cell wall properties for various applications

These applications represent promising avenues for translating fundamental knowledge about A. borkumensis mtgA into practical technologies addressing environmental, medical, and industrial challenges.

How might integrative research approaches advance our understanding of the relationship between mtgA, cell wall synthesis, and hydrocarbon degradation?

Advancing our understanding of the intricate relationships between mtgA, cell wall synthesis, and hydrocarbon degradation requires sophisticated integrative research approaches:

1. Multi-Omics Integration:

  • Combine transcriptomics, proteomics, and metabolomics data to create comprehensive models

  • Track changes across different growth conditions and stressors

  • Identify key regulatory nodes connecting cell wall synthesis and hydrocarbon metabolism

2. Systems Biology Modeling:

  • Develop mathematical models of peptidoglycan synthesis incorporating mtgA activity

  • Create predictive models of A. borkumensis response to hydrocarbon exposure

  • Simulate the effects of environmental changes on cell wall dynamics

3. Advanced Imaging Techniques:

  • Apply super-resolution microscopy to visualize mtgA localization during hydrocarbon degradation

  • Use correlative light and electron microscopy to connect protein localization with ultrastructural changes

  • Develop live-cell imaging approaches to track dynamic changes in cell envelope properties

4. Synthetic Biology Approaches:

  • Engineer minimal systems reconstructing the essential components of mtgA-mediated cell wall synthesis

  • Create synthetic gene circuits connecting hydrocarbon sensing to cell wall remodeling

  • Develop orthogonal systems to test hypotheses about mtgA function in isolation

5. Ecological and Environmental Integration:

  • Study natural A. borkumensis populations in different marine environments

  • Compare mtgA sequence and expression in strains from pristine versus oil-contaminated sites

  • Analyze community interactions affecting cell wall dynamics and hydrocarbon degradation

6. Evolutionary Analyses:

  • Compare mtgA sequences across multiple Alcanivorax species and related genera

  • Reconstruct the evolutionary history of cell wall adaptations to hydrocarbon utilization

  • Identify signatures of selection in cell wall synthesis genes from hydrocarbon-degrading bacteria

By integrating these diverse approaches, researchers can develop a comprehensive understanding of how A. borkumensis has adapted its cell wall synthesis machinery, particularly mtgA, to thrive in hydrocarbon-rich marine environments, potentially revealing novel principles of bacterial adaptation applicable to other extreme environments.

What emerging technologies might enhance research on recombinant A. borkumensis mtgA in the next decade?

Several cutting-edge technologies are likely to transform research on recombinant A. borkumensis mtgA in the coming decade:

1. Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for high-resolution structures of mtgA in different functional states

  • Integrative structural biology combining X-ray crystallography, NMR, and computational modeling

  • Time-resolved structural studies capturing transient conformational changes during catalysis

2. Artificial Intelligence and Machine Learning:

  • AI-driven protein engineering to optimize mtgA properties for specific applications

  • Machine learning algorithms to predict substrate specificity and inhibitor binding

  • Deep learning approaches to model complex relationships between cell wall synthesis and hydrocarbon metabolism

3. Next-Generation Protein Engineering:

  • Directed evolution using continuous evolution systems

  • Non-canonical amino acid incorporation for enhanced functionality

  • Computational design of novel catalytic activities based on mtgA scaffolds

4. Single-Cell and Single-Molecule Technologies:

  • Single-cell transcriptomics to capture heterogeneity in mtgA expression

  • Single-molecule tracking of mtgA dynamics in live cells

  • Nanoscale sensing of localized enzymatic activity in the cell envelope

5. Advanced Synthetic Biology Tools:

  • CRISPR-based precise genome editing for subtle modifications of mtgA

  • Cell-free expression systems for rapid prototyping of mtgA variants

  • Synthetic cell technologies to reconstruct minimal peptidoglycan synthesis systems

6. Microfluidics and Organ-on-Chip Technologies:

  • Microfluidic systems mimicking oil-water interfaces for studying A. borkumensis in controlled environments

  • Gradient-generating platforms to assess mtgA function under varying conditions

  • High-throughput droplet-based systems for enzyme variant screening

7. Advanced Computational Approaches:

  • Molecular dynamics simulations with enhanced sampling techniques

  • Quantum mechanics/molecular mechanics (QM/MM) calculations of reaction mechanisms

  • Agent-based modeling of bacterial populations during hydrocarbon degradation

These emerging technologies will likely enable unprecedented insights into the structure, function, and regulation of A. borkumensis mtgA, potentially leading to transformative applications in bioremediation, antimicrobial development, and industrial biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.