Recombinant Alcanivorax borkumensis Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; ABO_1036; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
nqrE
Target Protein Sequence
MFEHYLSLFVRAVFVENMALAFFLGMCTFIAISKKIQTAIGLGIAVVVVLAITVPVNNLI LHNLLEEGALSWTGSEQLASLDLRFLGLLSYIGVIAAIVQILEMTLDKYVPSLYNALGIF LPLITVNCAIMGASLFMVERDYTFGESVVYGVGAGVGWALAITLLAGIREKLKYSDVPDG LKGLGITFITVGLMSLGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Na(+)-translocating NADH-quinone reductase subunit E in Alcanivorax borkumensis?

The Na(+)-translocating NADH-quinone reductase subunit E (nqrE) in A. borkumensis is a key component of the respiratory chain that couples the oxidation of NADH to the translocation of sodium ions across the membrane. This respiratory complex is responsible for generating an electrochemical gradient of sodium ions, which can be utilized for various cellular processes including ATP synthesis, nutrient transport, and maintaining ion homeostasis. The NQR complex in A. borkumensis, similar to that in other bacteria like Vibrio cholerae, is a multi-subunit enzyme that catalyzes the oxidation of NADH and the reduction of quinones while pumping sodium ions across the membrane . The nqrE subunit specifically contributes to the formation of the transmembrane channel through which sodium ions are translocated.

How can recombinant nqrE be expressed in heterologous systems?

Recombinant expression of nqrE can be achieved using various expression systems, with Escherichia coli being the most common host. Based on similar approaches used for other subunits of the NQR complex, the following methodology is recommended:

  • Gene cloning: The nqrE gene can be amplified from A. borkumensis SK2 genomic DNA using PCR with specific primers containing appropriate restriction sites.

  • Expression vector selection: Due to the membrane-associated nature of nqrE, specialized vectors that allow tight regulation of expression and include appropriate fusion tags are recommended. A vector system similar to that used for NqrF expression, such as pET-based vectors in E. coli BL21(DE3)plysS, can be employed .

  • Expression conditions: Optimal expression often requires lower temperatures (16-25°C) and reduced inducer concentrations to prevent formation of inclusion bodies. For membrane proteins like nqrE, a slow induction approach using lower IPTG concentrations (0.1-0.5 mM) is advisable.

  • Co-expression strategies: Co-expression with chaperones or other NQR subunits may improve proper folding and stability of the recombinant protein.

This approach is similar to the methods used for expressing other membrane-associated proteins from A. borkumensis, such as AlkB2 .

How does the structure-function relationship of nqrE contribute to Na+ translocation?

The structure-function relationship of nqrE in Na+ translocation involves several key aspects:

  • Transmembrane topology: Based on the amino acid sequence, nqrE contains multiple hydrophobic segments that likely form transmembrane helices. These helices are arranged to create part of a channel or pathway for Na+ movement across the membrane.

  • Critical residues: Several conserved residues in nqrE are likely involved in Na+ coordination and translocation. These may include negatively charged amino acids (Asp, Glu) that interact with Na+ ions, as well as polar residues that participate in hydrogen bonding networks essential for ion movement.

  • Conformational changes: During the catalytic cycle, nqrE likely undergoes conformational changes in response to electron transfer events in other subunits of the complex. These conformational shifts would alter the accessibility of Na+ binding sites, facilitating directional movement of ions across the membrane.

  • Interaction with other subunits: The function of nqrE is dependent on its proper interaction with other NQR subunits. These interactions create a complete ion channel and ensure coupling between electron transfer and ion translocation.

To investigate these relationships, site-directed mutagenesis targeting conserved residues, coupled with functional assays measuring Na+ transport activities, would be essential. Additionally, structural studies using techniques such as cryo-electron microscopy could provide valuable insights into the three-dimensional arrangement of nqrE within the complex.

What methodologies can be used to assess the activity of recombinant nqrE in vitro?

Assessing the activity of recombinant nqrE in vitro presents challenges due to its integral membrane nature and dependence on other NQR subunits. The following methodologies can be employed:

  • Reconstitution in proteoliposomes:

    • Purify recombinant nqrE and reconstitute it into liposomes along with other NQR subunits

    • Establish a Na+ gradient across the liposome membrane

    • Monitor changes in this gradient using Na+-sensitive fluorescent dyes or radioisotope-labeled Na+

  • Electron transfer assays:

    • Measure electron transfer rates using various electron donors and acceptors

    • For the NQR complex, NADH serves as the electron donor, with rate measurements potentially reaching up to 20,000 μmol min⁻¹ mg⁻¹ as observed with the NqrF subunit

    • Monitor spectrophotometrically using dyes like ubiquinone analogs

  • Sodium ion transport measurements:

    • Utilize Na+-sensitive fluorescent probes (e.g., SBFI) to monitor Na+ movement

    • Employ 22Na+ radioisotope uptake assays with reconstituted proteoliposomes

  • Whole-cell bioenergetic studies:

    • Express nqrE along with other NQR components in a heterologous host

    • Assess the impact on membrane potential and sodium gradients

    • Measure respiratory activities in the presence of specific inhibitors

These methodologies require careful optimization of conditions, including buffer composition, pH, temperature, and ionic strength, to maintain protein stability and activity.

How does nqrE from A. borkumensis compare to homologous proteins in other bacteria?

Na(+)-translocating NADH-quinone reductase subunits are found in various bacteria, with significant differences in structure and function. A comparative analysis of nqrE from A. borkumensis with homologs from other bacteria reveals:

OrganismProteinSize (aa)Identity to A. borkumensis nqrE (%)Key Functional Differences
Alcanivorax borkumensisNqrE206100Adapted to marine environment, high salt tolerance
Vibrio choleraeNqrE~200~40-50*Part of a complex containing four flavins and a Fe-S cluster
Escherichia coliNone--Uses NDH-1 (Complex I) instead of NQR for NADH oxidation
Marine bacteriaNqrEVariesVariesGenerally adapted to Na+-dependent bioenergetics
Non-marine bacteriaNqrEVariesLowerOften less dependent on Na+ circulation

*Estimated based on typical conservation between these genera

The primary differences between these homologs relate to:

  • Salt adaptation: A. borkumensis nqrE is specifically adapted to function in marine environments with high salt concentrations 3.

  • Substrate specificity: The NQR complex in A. borkumensis may have evolved specific properties related to its hydrocarbon-degrading lifestyle, potentially affecting the exact role of nqrE.

  • Regulatory mechanisms: Expression and regulation of nqrE likely differ between organisms based on their metabolic requirements and ecological niches.

Comparative genomic and structural analyses suggest that while the core function of Na+ translocation is conserved, the specific mechanisms and regulatory features have diverged to suit the unique environmental conditions of each organism.

What role does nqrE play in the bioenergetics of A. borkumensis during hydrocarbon degradation?

The Na(+)-translocating NADH-quinone reductase complex, including the nqrE subunit, plays a critical role in the bioenergetics of A. borkumensis during hydrocarbon degradation:

  • Energy conservation during alkane oxidation: When A. borkumensis metabolizes hydrocarbons, the initial oxidation steps are carried out by alkane hydroxylases like AlkB1 and AlkB2 . These reactions generate reducing equivalents (NADH) that need to be recycled through the respiratory chain, where the NQR complex (including nqrE) plays a key role.

  • Adaptation to marine environments: Unlike many bacteria that use proton-pumping respiratory complexes, A. borkumensis relies significantly on sodium ion circulation for energy conservation, making the NQR complex (with nqrE) especially important in the high-sodium marine environment 3.

  • Metabolic flexibility: During growth on different hydrocarbon substrates, A. borkumensis must adjust its energy metabolism. The NQR complex provides metabolic flexibility by offering an alternative to proton-pumping respiratory complexes.

  • Support for biosurfactant production: A. borkumensis produces membrane-associated biosurfactants that aid in hydrocarbon uptake . The energy required for biosurfactant production and export is likely supported in part by the activity of the NQR complex.

Experimental evidence from growth studies of A. borkumensis on various carbon sources indicates that its bioenergetic systems, including the NQR complex, are optimized for efficient energy conservation during hydrocarbon metabolism . The bacterium shows improved growth rates on hydrocarbon substrates when provided with appropriate nutrients, suggesting effective coupling between hydrocarbon oxidation and energy conservation systems like the NQR complex.

How can site-directed mutagenesis be used to identify key functional residues in nqrE?

Site-directed mutagenesis provides a powerful approach to identify key functional residues in nqrE. A comprehensive mutagenesis strategy should include:

This methodical approach can identify residues essential for Na+ binding, channel formation, and coupling of electron transfer to ion translocation, providing insights into the molecular mechanism of nqrE function.

What are the optimal conditions for expressing and purifying functional recombinant nqrE?

Expressing and purifying functional recombinant nqrE requires carefully optimized conditions due to its hydrophobic, membrane-integrated nature:

  • Expression system optimization:

    • Host selection: E. coli strains specialized for membrane protein expression (C41/C43, BL21-AI)

    • Vector design: Include a cleavable affinity tag (His6, Strep-tag II) for purification

    • Promoter selection: Use tunable promoters (T7-lac, araBAD) for controlled expression levels

    • Growth conditions: Lower temperatures (16-20°C), longer induction times (12-24 hours), and reduced inducer concentrations (0.1-0.2 mM IPTG)

  • Membrane preparation:

    • Cell disruption: Gentle lysis using French press or sonication with protease inhibitors

    • Membrane isolation: Differential ultracentrifugation (typically 150,000-200,000 × g)

    • Membrane solubilization: Screen detergents (DDM, LMNG, DMNG) at various concentrations

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Optional ion exchange chromatography for further purification

  • Stabilization during purification:

    • Buffer optimization: pH 7.5-8.0, 100-300 mM NaCl, 5-10% glycerol

    • Addition of lipids: E. coli polar lipids or synthetic phospholipids (0.1-0.5 mg/ml)

    • Detergent concentration: Maintain 2-3× critical micelle concentration throughout

Similar approaches have been successfully used for other membrane proteins from A. borkumensis, such as the alkane hydroxylase system , and could be adapted for nqrE purification. The purified protein should be verified for integrity using SDS-PAGE and western blotting, and functionality can be assessed using reconstitution experiments as described in section 3.3.

How can recombinant nqrE be functionally reconstituted with other NQR subunits?

Functional reconstitution of recombinant nqrE with other NQR subunits requires a systematic approach:

  • Co-expression strategies:

    • Design a polycistronic construct containing multiple nqr genes in their natural order

    • Use compatible plasmids with different origins of replication for co-transformation

    • Employ dual-plasmid systems with complementary antibiotic resistance markers

    • Balance expression levels using different strength promoters or ribosome binding sites

  • Purification of the complete complex:

    • Introduce an affinity tag on one subunit (typically NqrA or NqrF) for complex purification

    • Use gentle detergents (DDM, LMNG) that maintain subunit interactions

    • Apply buffer conditions that preserve protein-protein interactions (150-300 mM NaCl, 5% glycerol)

  • Reconstitution into proteoliposomes:

    • Prepare liposomes from E. coli polar lipids or synthetic lipid mixtures

    • Mix detergent-solubilized NQR complex with preformed liposomes

    • Remove detergent gradually using Bio-Beads or controlled dialysis

    • Verify incorporation by sucrose gradient centrifugation or freeze-fracture electron microscopy

  • Functional validation:

    • Measure NADH:quinone oxidoreductase activity using ubiquinone analogs

    • Assess Na+ transport using 22Na+ uptake assays or Na+-sensitive fluorescent dyes

    • Establish an artificial membrane potential to drive Na+ transport

    • Compare activity with that of native complexes isolated from A. borkumensis

This approach would be similar to that used for studying the NqrF subunit from V. cholerae , but adapted for the multi-subunit complex including nqrE from A. borkumensis. Successful reconstitution would provide a platform for detailed mechanistic studies of nqrE function within the context of the complete NQR complex.

How can bioinformatic approaches contribute to understanding nqrE function?

Bioinformatic approaches offer valuable insights into nqrE function without requiring extensive experimental work:

  • Sequence analysis and conservation mapping:

    • Multiple sequence alignment of nqrE homologs from diverse bacteria

    • Identification of absolutely conserved residues that likely play critical functional roles

    • Conservation scoring using methods like ConSurf to visualize evolutionary constraints

    • Correlation analysis to identify co-evolving residues that may interact functionally

  • Structural prediction and modeling:

    • Transmembrane topology prediction using algorithms like TMHMM or Phobius

    • Ab initio or homology-based 3D structure prediction using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to predict protein dynamics and potential Na+ pathways

    • Docking simulations to model interactions with other NQR subunits

  • Genomic context analysis:

    • Examination of gene neighborhood and operon structure across different species

    • Prediction of regulatory elements controlling nqrE expression

    • Analysis of the complete A. borkumensis genome (3,120,143 base pairs) to identify metabolic pathways connected to NQR function

  • Systems biology integration:

    • Integration of nqrE function into metabolic models of A. borkumensis

    • Prediction of phenotypic consequences of nqrE mutations or deletion

    • Correlation of nqrE expression with global transcriptomic or proteomic data under different growth conditions

These computational approaches can guide experimental work by generating testable hypotheses about nqrE function and identifying specific residues or regions for targeted mutagenesis.

What spectroscopic techniques are most informative for studying nqrE structure and function?

Several spectroscopic techniques provide complementary information about nqrE structure and function:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm): Determines secondary structure composition (α-helices, β-sheets)

    • Near-UV CD (250-350 nm): Probes tertiary structure through aromatic amino acid environments

    • Thermal denaturation monitored by CD: Assesses protein stability and folding

  • Fourier Transform Infrared (FTIR) Spectroscopy:

    • Attenuated Total Reflection FTIR: Analyzes secondary structure in membrane environments

    • Hydrogen-Deuterium Exchange FTIR: Identifies solvent-accessible regions

    • Polarized FTIR: Determines orientation of α-helices within membranes

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling: Measures distances between specific residues

    • Continuous wave EPR: Detects paramagnetic centers and their environment

    • Pulsed EPR techniques (DEER/PELDOR): Measures long-range distances between spin labels

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solid-state NMR: Analyzes structure in membrane-mimetic environments

    • Solution NMR of soluble domains: Provides atomic-resolution structural information

    • 23Na NMR: Directly probes Na+ binding sites and dynamics

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence: Monitors local conformational changes

    • FRET measurements: Detects distance changes between labeled sites during function

    • Stopped-flow fluorescence: Captures rapid conformational changes during catalysis

Studies on the NqrF subunit from V. cholerae have successfully employed EPR, visible absorption, and CD spectroscopy to characterize its Fe-S cluster . Similar approaches could be applied to study nqrE, particularly when reconstituted with other NQR subunits.

How can isothermal titration calorimetry be used to characterize Na+ binding to nqrE?

Isothermal Titration Calorimetry (ITC) provides direct thermodynamic measurements of Na+ binding to nqrE, offering insights into binding affinity, stoichiometry, and associated energetics:

  • Sample preparation considerations:

    • Purify nqrE in detergent micelles or nanodiscs to maintain native-like membrane environment

    • Ensure high protein purity (>95%) and stability throughout the experiment

    • Carefully control buffer conditions (pH, ionic strength) to minimize background heat

    • Remove all Na+ from buffers using ion exchange resins, then add back precise amounts

  • Experimental design:

    • Direct titration: Inject concentrated Na+ solution into protein sample

    • Competitive binding: Displace bound Na+ with other cations (K+, Li+) to determine specificity

    • Temperature-dependent measurements: Collect data at multiple temperatures (15-35°C) to determine entropy and enthalpy contributions

  • Data analysis approach:

    • Fit binding isotherms to appropriate models (single-site, multiple independent sites, cooperative binding)

    • Extract thermodynamic parameters:

      • Dissociation constant (Kd): Typical values for Na+ binding proteins range from μM to mM

      • Binding stoichiometry (n): Number of Na+ binding sites per nqrE molecule

      • Enthalpy change (ΔH): Energy released or absorbed during binding

      • Entropy change (ΔS): Changes in disorder associated with binding

  • Validation experiments:

    • Site-directed mutagenesis of predicted Na+ binding residues should alter binding parameters

    • Comparison of wild-type and mutant binding profiles can confirm specific binding sites

    • Measurements at different pH values can reveal proton-coupled Na+ binding

This approach would provide quantitative insights into how nqrE interacts with Na+ ions, which is essential for understanding its role in the Na+ translocation mechanism of the NQR complex.

How might nqrE function be integrated into synthetic biology applications?

The integration of nqrE function into synthetic biology applications presents several exciting possibilities:

  • Engineered sodium-based bioenergetics:

    • Construction of minimal Na+-dependent respiratory systems in heterologous hosts

    • Engineering E. coli or other model organisms to utilize Na+ gradients instead of H+ gradients

    • Development of hybrid energy conservation systems combining elements of different ion-pumping complexes

  • Biosensing applications:

    • Creation of whole-cell biosensors for monitoring Na+ concentrations in environmental samples

    • Development of protein-based Na+ sensors utilizing conformational changes in nqrE

    • Integration of nqrE-based sensing elements with reporter systems for real-time monitoring

  • Bioremediation enhancement:

    • Engineering improved versions of A. borkumensis with optimized NQR complexes for enhanced growth in oil-contaminated environments

    • Development of microbial consortia with complementary metabolic capabilities for more efficient bioremediation

    • Creation of synthetic microorganisms combining hydrocarbon degradation pathways from A. borkumensis with robust growth characteristics of other species

  • Bioelectrochemical systems:

    • Design of microbial fuel cells utilizing Na+ gradients for electricity generation

    • Development of bioelectrochemical sensors based on electron transfer through NQR components

    • Creation of hybrid biological-electronic interfaces for energy conversion or sensing

These applications would benefit from a deeper understanding of nqrE structure-function relationships and the ability to express and manipulate the protein in heterologous systems, similar to approaches used for other components from A. borkumensis .

What emerging technologies could advance our understanding of nqrE dynamics?

Several emerging technologies hold promise for advancing our understanding of nqrE dynamics:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination of the complete NQR complex

    • Time-resolved cryo-EM to capture different conformational states during the catalytic cycle

    • Electron tomography to visualize nqrE in its native membrane environment

  • Advanced computational approaches:

    • Molecular dynamics simulations with enhanced sampling techniques to model Na+ movement

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron transfer events

    • Machine learning approaches to predict functional sites and conformational changes

  • High-throughput mutagenesis and screening:

    • Deep mutational scanning to comprehensively assess the impact of mutations across nqrE

    • Microfluidics-based screening systems for rapidly assessing variant functionality

    • In vivo directed evolution approaches to identify optimized variants

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes in real-time

    • Patch-clamp fluorometry to simultaneously measure ion movement and protein dynamics

    • Atomic force microscopy to probe mechanical properties and conformational states

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes to determine subunit stoichiometry

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and interfaces

    • Cross-linking mass spectrometry to identify interaction sites between nqrE and other subunits

These technologies, used in combination, could provide unprecedented insights into how nqrE functions within the NQR complex, particularly regarding the coupling mechanism between electron transfer and Na+ translocation.

How does the function of nqrE contribute to A. borkumensis adaptation to marine oil-contaminated environments?

The function of nqrE as part of the Na(+)-translocating NADH-quinone reductase complex contributes significantly to A. borkumensis adaptation to marine oil-contaminated environments through several mechanisms:

  • Energy conservation in high-salt environments:

    • The Na+-based bioenergetics system is particularly well-suited to marine environments with high Na+ concentrations 3

    • By utilizing the natural Na+ gradient, A. borkumensis can conserve energy more efficiently than organisms using solely H+-based systems

    • This energy efficiency is critical during the rapid growth phase observed when A. borkumensis dominates microbial communities in oil-contaminated seawater3

  • Support for alkane degradation pathways:

    • The metabolism of alkanes by A. borkumensis generates NADH through the action of alkane hydroxylases like AlkB1 and AlkB2

    • The NQR complex, including nqrE, plays a crucial role in recycling this NADH, maintaining redox balance during hydrocarbon degradation

    • This capability allows A. borkumensis to become the predominant organism in crude-oil-containing seawater, accounting for up to 90% of the microbial community during oil spills

  • Enhanced stress tolerance:

    • The Na+-based bioenergetics system may contribute to A. borkumensis resistance to various stressors present in oil-contaminated marine environments

    • By maintaining proper ion gradients, the NQR complex helps preserve cellular homeostasis under challenging conditions

    • This stress tolerance enables A. borkumensis to thrive in environments that are inhospitable to many other microorganisms

  • Integration with biosurfactant production:

    • A. borkumensis produces biosurfactants that enhance hydrocarbon uptake and utilization

    • The energy required for biosurfactant synthesis and export is likely supported by the efficient energy conservation system that includes the NQR complex

    • This creates a synergistic relationship where energy generation supports biosurfactant production, which in turn enhances access to hydrocarbons as energy sources

Understanding these adaptations could inform bioremediation strategies and potentially lead to engineered systems with enhanced oil-degrading capabilities for environmental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.