Recombinant Alcanivorax borkumensis UPF0059 membrane protein ABO_2478 (ABO_2478)

Shipped with Ice Packs
In Stock

Description

Protein Overview

ABO_2478 (UniProt ID: Q0VLM2) is a 186-amino acid membrane protein encoded by the ABO_2478 gene. Recombinant production involves expressing the full-length protein in Escherichia coli with an N-terminal His tag for purification .

PropertyDetails
Source OrganismAlcanivorax borkumensis SK2
Expression SystemEscherichia coli
TagN-terminal His tag
Amino Acid Range1–186
Molecular FunctionMembrane-associated; putative role in hydrocarbon metabolism or transport
Storage-20°C/-80°C upon receipt
Catalog NumberRFL1821AF

Production and Applications

The recombinant ABO_2478 is produced in E. coli for biochemical studies. Key applications include:

  • Functional assays to elucidate its role in alkane metabolism pathways.

  • Structural studies (e.g., crystallography) to resolve its 3D architecture .

  • Biotechnological engineering of A. borkumensis strains for enhanced oil-spill remediation .

Research Gaps and Future Directions

Despite its availability, ABO_2478 lacks detailed mechanistic studies. Priorities include:

  • Substrate specificity profiling to identify interacting hydrocarbons or cofactors.

  • Gene knockout studies to assess its necessity in A. borkumensis’s metabolic network .

  • Comparative analyses with homologs like AlkB2, which hydroxylates alkanes via rubredoxin-mediated electron transfer .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special requests for the format. Please indicate your preference in the order notes and we will fulfill it if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. For working aliquots, store at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us and we will prioritize its development.
Synonyms
mntP; ABO_2478; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Target Names
mntP
Target Protein Sequence
MNPIALLLLAFAMSTDAFAAAIGKGAILKKPRLTEAFRIGIIFGSIEAITPLVGWLIGKS AASYVEAWDHWIAFSLLTVLGLHMIYEGTRPDGGSEEHKAQKMSLLRTCLTAFSTSIDAM AVGVSLAFINVNIWIASALIGLATTLMVTIGIMLGRAIGSVMGHRAEIFGGLTLIAVGAW ILYGQL
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: abo:ABO_2478

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Alcanivorax borkumensis and why is its UPF0059 membrane protein ABO_2478 significant?

Alcanivorax borkumensis is a ubiquitous marine petroleum oil-degrading bacterium with an unusual physiology specialized for alkane metabolism. This hydrocarbonoclastic bacterium degrades an exceptionally broad range of alkane hydrocarbons but few other substrates . A. borkumensis can dramatically increase in numbers after an oil spill and become the most abundant microbe in oil-polluted waters .

The UPF0059 membrane protein ABO_2478 belongs to a family of uncharacterized proteins found across various bacterial species. While its exact function remains uncharacterized, its presence in a specialized alkane-degrading organism suggests potential involvement in membrane adaptations necessary for the hydrocarbonoclastic lifestyle. The protein may play a role in membrane restructuring, which is known to occur during growth on alkanes to accommodate the massive influx of alkane oxidation enzymes .

What experimental approaches should be used to study the expression patterns of ABO_2478?

For studying ABO_2478 expression patterns, researchers should consider:

  • Comparative proteomics: Compare protein expression levels between cells grown on different carbon sources (e.g., hexadecane vs. pyruvate), similar to studies that have identified 97 differentially expressed proteins between these growth conditions .

  • Quantitative PCR: Monitor ABO_2478 gene expression levels during growth on different alkanes to determine if expression correlates with specific hydrocarbon chain lengths.

  • Promoter reporter fusions: Create fusions of the ABO_2478 promoter region with reporter genes (GFP, luciferase) to visualize expression patterns in real-time.

  • Western blot analysis: Develop antibodies against ABO_2478 to monitor protein levels in different growth conditions and cellular fractions.

  • Membrane fractionation: Isolate specific membrane fractions to determine the subcellular localization of ABO_2478 and how this changes under different growth conditions.

The optimal approach should mirror the growth conditions used in previous A. borkumensis studies: ONR7a medium at 30°C with either 1.5% hexadecane or 2% pyruvate as carbon sources .

How does ABO_2478 compare to other membrane proteins involved in A. borkumensis alkane metabolism?

The membrane proteome of A. borkumensis includes several well-characterized components involved in alkane metabolism:

Protein TypeExamplesKnown FunctionRegulation
Alkane hydroxylation systemsAlkB1 gene clusterInitial oxidation of alkanesInduced by alkanes
P450 cytochrome monooxygenaseAlternative alkane oxidationInduced by alkanes
Flavin-binding monooxygenaseAlternative alkane oxidationInduced by alkanes
Fatty acid metabolismβ-oxidation enzymesConversion of fatty acids to metabolic intermediatesUp-regulated during alkane growth
Membrane modificationEnzymes for unsaturated fatty acid synthesisMembrane restructuringUp-regulated during alkane growth
Cardiolipin synthesis enzymesMembrane restructuringUp-regulated during alkane growth
Transport systemsLipoprotein releasing system (Lol)Biosurfactant releaseUp-regulated during alkane growth

While specific information about ABO_2478 is limited in the available literature, as a membrane protein its function likely relates to one of these categories, potentially contributing to membrane adaptation during growth on alkanes .

What is known about the UPF0059 protein family in bacteria?

The UPF0059 family (Uncharacterized Protein Family 0059) represents a group of bacterial membrane proteins whose specific functions remain largely unknown. General characteristics of this family include:

  • Membrane localization: Typically integral membrane proteins with multiple predicted transmembrane domains.

  • Conservation: Relatively conserved across diverse bacterial species, suggesting fundamental cellular functions.

  • Structural features: Often contain hydrophobic domains consistent with membrane insertion.

  • Limited functional data: Few experimental studies have directly addressed the function of proteins in this family.

In the context of A. borkumensis, the presence of a UPF0059 family protein (ABO_2478) in this highly specialized bacterium suggests potential involvement in the unique membrane adaptations required for its hydrocarbonoclastic lifestyle .

What expression systems and purification strategies are most effective for recombinant ABO_2478 production?

Based on the characteristics of membrane proteins from A. borkumensis, the following strategies would be most effective for recombinant ABO_2478 production:

Expression Systems:

  • E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

  • Cell-free expression systems with membrane mimetics

  • Homologous expression in A. borkumensis itself

Vector Design:

  • Inducible promoters with fine-tuned expression control

  • Fusion tags (His-tag, MBP, SUMO) to enhance solubility and facilitate purification

  • Fluorescent protein fusions to monitor expression and folding

Growth Parameters:

  • Temperature: 30°C (matching A. borkumensis optimal growth temperature)

  • Medium: Modified ONR7a medium with appropriate salt concentration

  • Induction: Slow induction at lower temperatures to facilitate proper folding

Purification Approach:

  • Detergent screening: Test multiple detergents for optimal solubilization

  • Two-step purification: Affinity chromatography followed by size exclusion

  • Reconstitution into nanodiscs or liposomes for functional studies

Optimization should focus on maintaining the native environment of this marine bacterial protein, potentially including marine-relevant salt concentrations during expression and purification .

How can structural biology techniques be applied to understand ABO_2478 function?

Multiple structural biology approaches can provide insights into ABO_2478 function:

X-ray Crystallography:

  • Challenges: Crystallization of membrane proteins requires extensive detergent screening and optimization

  • Strategy: Utilize lipidic cubic phase crystallization, which has proven successful for many membrane proteins

  • Expected outcome: High-resolution structure revealing detailed molecular architecture

Cryo-Electron Microscopy:

  • Advantages: Does not require crystallization, can capture multiple conformational states

  • Approach: Reconstitution into nanodiscs or amphipols to maintain native-like environment

  • Applications: Particularly valuable if ABO_2478 forms larger complexes with other proteins

NMR Spectroscopy:

  • Utility: Provides dynamic information about protein motion and ligand binding

  • Limitations: Challenging for larger membrane proteins, may require selective labeling

  • Focus areas: Mapping alkane binding sites, detecting conformational changes

Hydrogen-Deuterium Exchange Mass Spectrometry:

  • Purpose: Identifies regions with altered solvent accessibility upon ligand binding

  • Benefit: Can work with limited amounts of protein and doesn't require crystallization

  • Target: Detect conformational changes upon exposure to different alkanes

Molecular Dynamics Simulations:

  • Integration: Complement experimental structures with simulations in membrane environments

  • Investigation: Predict alkane binding sites and protein dynamics in presence of hydrocarbons

  • Context: Model ABO_2478 within a membrane composition similar to A. borkumensis

The integration of multiple structural techniques would provide complementary information about how ABO_2478 might function in the context of A. borkumensis' specialized alkane metabolism .

What methodologies can resolve contradictory functional predictions for ABO_2478?

Resolving contradictory functional predictions for ABO_2478 requires a systematic multi-faceted approach:

Experimental Validation Hierarchy:

  • Genetic Approaches:

    • Gene deletion in A. borkumensis with phenotypic characterization

    • Complementation studies with mutated versions to identify essential residues

    • Heterologous expression to test functional predictions

  • Biochemical Characterization:

    • Direct binding assays with potential substrates (alkanes, lipids)

    • Activity assays based on predicted functions

    • Protein-protein interaction studies to identify functional partners

  • Structural Studies:

    • Structure determination to identify potential functional sites

    • Ligand binding studies using structural methods

    • Computational docking of potential substrates

  • Systems Biology Integration:

    • Transcriptomic analysis to identify co-regulated genes

    • Metabolomic studies to detect changes associated with ABO_2478 activity

    • Network analysis to place ABO_2478 in functional pathways

  • Evolutionary Analysis:

    • Comparative genomics across Alcanivorax species

    • Analysis of selective pressure on different protein domains

    • Correlation between ABO_2478 sequence variants and ecological niches

For each contradictory prediction, researchers should design targeted experiments that can specifically discriminate between alternative hypotheses, prioritizing approaches that align with the known biology of A. borkumensis and its membrane adaptations during growth on alkanes .

How might ABO_2478 contribute to the ecological success of A. borkumensis in oil-contaminated environments?

Based on the proteomic changes observed in A. borkumensis during growth on alkanes, several hypotheses can be formulated regarding ABO_2478's potential ecological role:

Potential Ecological Functions:

  • Membrane Adaptation:

    • A. borkumensis undergoes significant membrane restructuring when growing on alkanes

    • ABO_2478 may help maintain membrane integrity in the presence of hydrophobic compounds

    • Could facilitate the incorporation of specific lipids (unsaturated fatty acids, cardiolipin) that are upregulated during alkane growth

  • Alkane Processing:

    • May function in alkane sensing, transport, or localization

    • Could interact with the three known alkane oxidation systems

    • Might facilitate the concentration of alkanes near degradative enzymes

  • Stress Response:

    • Oil-contaminated environments present multiple stressors (hydrophobic compounds, limited nutrients)

    • ABO_2478 could contribute to stress tolerance mechanisms

    • May protect against membrane disruption by hydrocarbon intercalation

  • Biofilm Formation:

    • A. borkumensis forms biofilms on oil-water interfaces

    • ABO_2478 could participate in cell-surface interactions

    • May contribute to community formation at the oil-water interface

The ecological success of A. borkumensis during oil spills, where it becomes the dominant species despite being present at low numbers in unpolluted environments, suggests highly specialized adaptation mechanisms in which membrane proteins like ABO_2478 likely play important roles .

What are the optimal conditions for heterologous expression and purification of ABO_2478?

Developing optimal conditions for ABO_2478 expression requires systematic optimization of multiple parameters:

Expression System Selection:

SystemAdvantagesConsiderations for ABO_2478
E. coli BL21(DE3)Well-established, high yieldMay not provide optimal membrane insertion
E. coli C41/C43Designed for membrane proteinsBetter tolerance for potentially toxic membrane proteins
Cell-free systemsAvoids toxicity issuesRequires optimization of membrane mimetics
Pichia pastorisEukaryotic folding machineryLonger development time, different membrane composition

Vector and Construct Design:

  • Promoter selection: Test IPTG-inducible (T7) versus auto-induction systems

  • Fusion partners: Compare solubility/folding enhancers (MBP, SUMO) with purification tags (His, Strep)

  • Signal sequences: Evaluate native versus optimized membrane targeting sequences

  • Codon optimization: Essential for heterologous expression in E. coli

Growth and Induction Protocol:

  • Temperature: Evaluate standard (37°C) versus reduced temperature (16-25°C)

  • Media composition: Test standard media versus adaptations incorporating elements of ONR7a medium (used for A. borkumensis cultivation)

  • Induction timing: Early-log versus mid-log phase induction

  • Inducer concentration: Titration to find optimal expression level

Purification Strategy Development:

  • Membrane extraction: Systematic screening of detergents (DDM, LDAO, etc.)

  • Purification method: IMAC followed by size exclusion chromatography

  • Buffer optimization: Salt concentration, pH, stabilizing additives

  • Quality assessment: SEC-MALS, thermal stability assays, activity measurements

This systematic approach should be documented with clear decision points and validation criteria to establish reproducible protocols for ABO_2478 production .

How can functional assays be designed to determine ABO_2478's role in alkane metabolism?

Designing functional assays for ABO_2478 requires consideration of its potential roles in A. borkumensis' alkane metabolism:

Binding Assays:

  • Isothermal Titration Calorimetry (ITC) with various alkanes to determine binding affinities

  • Microscale Thermophoresis (MST) to measure interactions with hydrophobic substrates

  • Surface Plasmon Resonance (SPR) with immobilized protein and flowing hydrocarbon analogs

  • Fluorescence-based assays using environment-sensitive probes to detect conformational changes

Transport Assays:

  • Reconstitution into liposomes with fluorescent alkane analogs to measure transport

  • Whole-cell alkane uptake comparing wild-type and ABO_2478 deletion mutants

  • Artificial membrane systems (black lipid membranes) for electrophysiological measurements

Protein Interaction Studies:

  • Pull-down assays to identify interactions with known alkane metabolism proteins

  • Bacterial two-hybrid assays for in vivo interaction studies

  • Cross-linking mass spectrometry to map precise interaction interfaces

  • Co-localization studies using fluorescently tagged proteins

In Vivo Functional Assessment:

  • Gene deletion studies monitoring growth on different alkanes

  • Complementation assays with mutated versions to identify critical residues

  • Reporter assays measuring membrane stress in the presence/absence of ABO_2478

  • Metabolomic analysis to detect changes in alkane metabolism intermediates

Each assay should include appropriate controls and be designed to distinguish between alternative hypotheses about ABO_2478's function in the context of A. borkumensis' adaptation to growth on alkanes .

What approaches can detect potential interactions between ABO_2478 and the three alkane oxidation systems?

Detecting interactions between ABO_2478 and the three known alkane oxidation systems in A. borkumensis (alkB1 gene cluster, P450 cytochrome monooxygenase, and putative flavin-binding monooxygenase) requires specialized approaches for membrane protein interactions:

In Vitro Interaction Methods:

  • Co-immunoprecipitation with membrane-compatible detergents:

    • Optimize detergent conditions to maintain native interactions

    • Use antibodies against ABO_2478 or tagged versions of the protein

    • Identify co-precipitating proteins by mass spectrometry

  • Biolayer Interferometry:

    • Immobilize purified ABO_2478 on biosensors

    • Test binding of purified components of alkane oxidation systems

    • Measure association/dissociation kinetics

  • Chemical Cross-linking:

    • Apply membrane-permeable cross-linkers to intact cells

    • Identify cross-linked partners by mass spectrometry

    • Map interaction interfaces at amino acid resolution

  • FRET/BRET Analysis:

    • Create fusion proteins with appropriate fluorophore pairs

    • Measure energy transfer as indicator of proximity

    • Test in reconstituted systems or intact membranes

In Vivo Interaction Methods:

  • Split-protein Complementation:

    • Fuse fragments of reporter proteins (GFP, luciferase) to potential partners

    • Measure signal reconstitution when proteins interact

    • Test in heterologous hosts or in A. borkumensis directly

  • Proximity Labeling:

    • Fuse ABO_2478 to enzymes like BioID or APEX2

    • Identify proximal proteins through biotinylation patterns

    • Particularly valuable for transient interactions

  • Co-localization Microscopy:

    • Create fluorescently tagged versions of interaction partners

    • Track localization patterns during growth on alkanes

    • Apply super-resolution techniques for detailed spatial analysis

  • Genetic Interaction Analysis:

    • Create combination knockouts with components of alkane oxidation systems

    • Look for synthetic phenotypes indicating functional relationships

    • Test growth on alkanes of varying chain lengths

These complementary approaches would provide a comprehensive picture of how ABO_2478 might function within the complex membrane-associated machinery for alkane oxidation in A. borkumensis .

What methodological challenges exist in studying membrane proteins like ABO_2478, and how can they be overcome?

Studying membrane proteins like ABO_2478 presents numerous methodological challenges that require specialized approaches:

Expression and Purification Challenges:

ChallengeSolution Strategies
Low expression levelsOptimize codon usage, use specialized expression strains, test different fusion tags
Toxicity to host cellsUse tightly regulated promoters, lower induction temperatures, cell-free expression systems
Improper membrane insertionInclude proper signal sequences, consider homologous expression in A. borkumensis
Aggregation during purificationScreen multiple detergents, include stabilizing lipids, use gentle solubilization procedures
Instability in solutionAdd lipids or cholesterol, use amphipols or nanodiscs for stabilization

Structural Analysis Challenges:

  • Crystallization difficulties:

    • Utilize lipidic cubic phase crystallization

    • Create fusion proteins with crystallization chaperones

    • Consider alternative approaches like cryo-EM

  • NMR size limitations:

    • Focus on specific domains or peptide fragments

    • Use selective isotope labeling strategies

    • Apply solid-state NMR approaches

  • Maintaining native conformation:

    • Reconstitute in nanodiscs or native-like lipid environments

    • Validate structural integrity through functional assays

    • Compare results across multiple structural approaches

Functional Characterization Challenges:

  • Working with hydrophobic substrates:

    • Develop assays compatible with poor water solubility of alkanes

    • Use fluorescent or isotope-labeled alkane analogs

    • Include appropriate controls for non-specific interactions

  • Reconstituting multicomponent systems:

    • Develop co-expression systems for interacting proteins

    • Optimize reconstitution into proteoliposomes

    • Create minimal systems with essential components

  • Correlating in vitro and in vivo functions:

    • Generate conditional knockouts in A. borkumensis

    • Design complementation assays with mutated versions

    • Use whole-cell assays where possible

These methodological challenges require interdisciplinary approaches combining membrane biochemistry, structural biology, and microbial physiology, particularly considering the specialized nature of A. borkumensis as a marine hydrocarbonoclastic bacterium .

How can bioinformatic approaches predict ABO_2478 function within the context of alkane metabolism?

Bioinformatic approaches can provide valuable insights into the potential functions of ABO_2478 within A. borkumensis' specialized alkane metabolism:

Sequence-Based Analyses:

  • Homology detection:

    • Use sensitive profile-based methods (HHpred, HMMER)

    • Search against specialized membrane protein databases

    • Consider distant relationships that standard BLAST might miss

  • Domain architecture analysis:

    • Identify conserved domains and motifs using Pfam/InterPro

    • Compare with proteins of known function in alkane metabolism

    • Look for binding sites or catalytic signatures

  • Transmembrane topology prediction:

    • Apply multiple predictors (TMHMM, TOPCONS, Phobius)

    • Identify potential substrate-binding regions

    • Map conserved residues onto predicted structure

Structure-Based Approaches:

  • 3D structure prediction:

    • Use AlphaFold or RoseTTAFold for ab initio prediction

    • Validate predictions through conservation mapping

    • Identify potential ligand-binding pockets

  • Molecular docking:

    • Dock alkanes and alkane derivatives to predicted structures

    • Identify potential binding sites and interaction modes

    • Calculate binding energies for different substrates

Genomic Context Analysis:

  • Gene neighborhood examination:

    • Analyze genes adjacent to ABO_2478 across Alcanivorax species

    • Identify conserved genomic context suggesting functional relationships

    • Look for co-occurrence with known alkane metabolism genes

  • Regulon prediction:

    • Identify potential regulatory elements in the ABO_2478 promoter

    • Compare with promoters of known alkane metabolism genes

    • Predict co-regulation with specific metabolic pathways

The integration of these complementary approaches can generate testable hypotheses about ABO_2478's role in the context of A. borkumensis' specialized adaptations for alkane metabolism .

How can proteomic data be integrated to understand ABO_2478's regulation during growth on different alkanes?

Integration of proteomic data provides powerful insights into ABO_2478's regulation and function:

Differential Expression Analysis:

  • Condition-specific expression patterns:

    • Compare ABO_2478 levels during growth on different carbon sources (alkanes vs. pyruvate)

    • Analyze expression across alkanes of varying chain lengths

    • Monitor temporal expression patterns during adaptation to alkanes

  • Correlation analysis:

    • Identify proteins with similar expression patterns to ABO_2478

    • Apply clustering algorithms to group co-regulated proteins

    • Compare with known alkane-regulated proteins (97 proteins already identified)

Post-Translational Modification Analysis:

  • Modification site mapping:

    • Identify phosphorylation, glycosylation, or other modifications

    • Compare modification patterns across growth conditions

    • Correlate modifications with metabolic shifts

  • Turnover analysis:

    • Measure protein half-life using pulse-chase proteomics

    • Compare stability during growth on different substrates

    • Identify potential regulatory degradation pathways

Protein Localization and Interaction Studies:

  • Membrane microdomain analysis:

    • Fractionate membranes and track ABO_2478 distribution

    • Identify co-localizing proteins through proximity proteomics

    • Compare with known alkane oxidation system components

  • Interaction network construction:

    • Use affinity purification-mass spectrometry data

    • Build interaction networks across different growth conditions

    • Map ABO_2478 within the broader alkane metabolism network

Multi-omics Integration:

  • Correlation with transcriptomic data:

    • Compare protein expression with transcript levels

    • Identify potential post-transcriptional regulation

    • Analyze promoter activity across conditions

  • Metabolomic correlation:

    • Associate ABO_2478 levels with metabolite profiles

    • Identify potential metabolites affected by ABO_2478 activity

    • Create integrated pathway maps connecting protein expression to metabolic outcomes

This integrated approach builds upon existing proteomic studies of A. borkumensis that have identified differential expression of 97 proteins between hexadecane and pyruvate growth conditions .

What computational approaches can model ABO_2478's role in membrane adaptation during alkane metabolism?

Computational modeling can provide valuable insights into ABO_2478's potential role in membrane adaptation during alkane metabolism:

Molecular Dynamics Simulations:

  • Membrane insertion modeling:

    • Simulate ABO_2478 within lipid bilayers of varying composition

    • Model the effects of alkane presence on protein-membrane interactions

    • Analyze protein stability and conformational changes in different membrane environments

  • Alkane interaction simulations:

    • Model interactions between ABO_2478 and alkanes of varying chain lengths

    • Identify potential alkane binding sites and transport pathways

    • Calculate energetics of alkane-protein interactions

  • Membrane perturbation analysis:

    • Simulate the effects of alkanes on membrane properties

    • Model how ABO_2478 might counteract these perturbations

    • Analyze changes in membrane thickness, fluidity, and lateral organization

Systems Biology Approaches:

  • Metabolic modeling:

    • Incorporate ABO_2478 into genome-scale metabolic models of A. borkumensis

    • Simulate growth on different alkanes with and without ABO_2478 function

    • Identify metabolic bottlenecks and potential regulatory points

  • Protein-protein interaction networks:

    • Predict functional interactions based on co-expression data

    • Build interaction networks connecting ABO_2478 to alkane metabolism pathways

    • Identify potential functional modules within these networks

  • Evolutionary simulations:

    • Model the evolution of ABO_2478 across Alcanivorax species

    • Correlate sequence changes with adaptations to different hydrocarbon sources

    • Identify signatures of selection pointing to functional importance

Multi-scale Modeling:

These computational approaches can generate testable hypotheses about how ABO_2478 contributes to the remarkable ability of A. borkumensis to thrive in oil-contaminated marine environments .

How can contradictory experimental results regarding ABO_2478 function be reconciled through data integration?

Reconciling contradictory experimental results requires systematic data integration approaches:

Methodological Reconciliation:

  • Experimental condition analysis:

    • Compare precise experimental conditions (temperature, media, growth phase)

    • Identify potential condition-dependent effects

    • Replicate contradictory experiments under identical conditions

  • Methodological bias assessment:

    • Evaluate potential biases in different experimental approaches

    • Consider technical limitations of each method

    • Design orthogonal experiments to break methodological ties

Biological Context Integration:

  • Multi-functional hypothesis testing:

    • Consider that ABO_2478 may have multiple distinct functions

    • Test condition-specific or substrate-specific roles

    • Develop assays that can distinguish between alternative functions

  • Strain and species variation analysis:

    • Compare results across different A. borkumensis strains

    • Consider evolutionary divergence in protein function

    • Evaluate potential strain-specific adaptations

Quantitative Data Integration:

  • Bayesian integration framework:

    • Assign confidence scores to different experimental results

    • Update probability estimates as new data becomes available

    • Generate consensus predictions with uncertainty estimates

  • Meta-analysis approaches:

    • Systematically analyze results across multiple studies

    • Identify factors explaining heterogeneity in results

    • Calculate combined effect sizes across studies

Computational Validation:

This systematic approach to data integration can help resolve apparent contradictions and develop a more comprehensive understanding of ABO_2478's complex role in A. borkumensis' specialized metabolism and ecological success in oil-contaminated environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.