Recombinant Alcanivorax borkumensis UPF0060 membrane protein ABO_1373 (ABO_1373)

Biological Context of Alcanivorax borkumensis

Alcanivorax borkumensis is a specialized marine bacterium primarily known for its hydrocarbon-degrading capabilities. This rod-shaped, non-flagellated bacterium was initially isolated from North Sea sediments and has since been identified in various marine environments worldwide, particularly in areas with petroleum oil presence. It functions as an alkane-degrader, metabolizing hydrocarbons in the presence of oxygen, making it ecologically significant for natural bioremediation processes in marine oil spills. The bacterium thrives in saline environments (1-12.5% salinity) and moderate temperatures (4-35°C), demonstrating its adaptation to diverse oceanic conditions .

Molecular Characteristics of ABO_1373 Protein

ABO_1373 is classified as a UPF0060 family membrane protein consisting of 109 amino acids. The recombinant form most commonly studied features an N-terminal His-tag and is typically expressed in E. coli expression systems. The protein's amino acid sequence is:
MLALYTLGLFILTAVTEIVGCYLPYLWLKKSAPGWVLLPAAASLAMFAWLLSLHPTDAGRVYAAYGGVYVFVALLWLWGVEGVRPHPWDFVGVAVALAGMGIIMFAPRG .

This sequence contains predominantly hydrophobic amino acids, consistent with its membrane localization. The protein is registered in the UniProt database under accession number Q0VPS7 .

What is the cellular localization of ABO_1373 protein?

The ABO_1373 protein is a membrane-embedded protein as indicated by both its classification (UPF0060 membrane protein) and amino acid sequence analysis. The high proportion of hydrophobic residues in its sequence suggests multiple transmembrane domains. Computational topology prediction indicates the protein likely traverses the bacterial cell membrane multiple times, with both intracellular and extracellular domains. When conducting subcellular localization studies, researchers should employ membrane fraction isolation techniques such as ultracentrifugation with sucrose gradients, followed by Western blotting using anti-His antibodies for the recombinant protein detection .

What expression systems are optimal for producing recombinant ABO_1373?

Escherichia coli represents the primary expression system for recombinant ABO_1373 production. The protein's relatively small size (109 amino acids) and prokaryotic origin make E. coli a suitable host. When expressing this membrane protein, BL21(DE3) strains with modifications for membrane protein expression (like C41/C43 derivatives) generally yield better results. Expression should be conducted at lower temperatures (16-20°C) to minimize inclusion body formation and promote proper membrane integration. The addition of an N-terminal His-tag facilitates downstream purification through immobilized metal affinity chromatography (IMAC), though the tag's potential interference with function should be considered in functional studies .

What are the recommended storage conditions for purified ABO_1373?

For optimal stability, purified recombinant ABO_1373 should be stored at -20°C or preferably -80°C. The protein is typically supplied as a lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. After reconstitution, addition of glycerol to a final concentration of 5-50% is recommended to prevent freezing damage. The standard storage buffer consists of Tris/PBS-based solution with 6% trehalose at pH 8.0. Repeated freeze-thaw cycles significantly reduce protein stability and activity, so working aliquots should be maintained at 4°C for up to one week. For long-term storage, small-volume aliquots should be prepared to minimize freeze-thaw cycles .

How does the membrane topology of ABO_1373 relate to its potential function?

The membrane topology of ABO_1373, with its predicted multiple transmembrane domains, suggests potential roles in transport, signaling, or membrane structural integrity. Hydropathy plot analysis of its sequence (MLALYTLGLFILTAVTEIVGCYLPYLWLKKSAPGWVLLPAAASLAMFAWLLSLHPTDAGRVYAAYGGVYVFVALLWLWGVEGVRPHPWDFVGVAVALAGMGIIMFAPRG) reveals distinct hydrophobic regions consistent with transmembrane helices. To experimentally determine topology, researchers should consider cysteine-scanning mutagenesis coupled with accessibility assays, or fluorescence-based approaches using GFP fusion constructs at various positions. The UPF0060 family remains functionally uncharacterized, presenting opportunities for novel functional discovery through comparative genomics with other members of this protein family .

What role might ABO_1373 play in hydrocarbon metabolism of A. borkumensis?

Given A. borkumensis' specialization in hydrocarbon degradation, ABO_1373 may participate in alkane transport, sensing, or processing pathways. While direct evidence for ABO_1373's involvement in hydrocarbon metabolism is not explicitly provided in the current literature, its membrane localization makes it a candidate for hydrocarbon transport or sensing functions. Research approaches should include gene knockout studies to assess phenotypic changes in hydrocarbon utilization, metabolic flux analysis in mutant strains, and protein-protein interaction studies to identify associations with known alkane degradation enzymes. Transcriptomic or proteomic analysis comparing expression levels under different hydrocarbon exposures would provide insights into its regulatory response to these substrates .

How might post-translational modifications affect ABO_1373 function?

While bacterial proteins generally undergo fewer post-translational modifications (PTMs) than eukaryotic proteins, potential modifications like phosphorylation, acetylation, or lipidation could significantly impact ABO_1373 function. Researchers should employ mass spectrometry-based proteomic approaches to identify PTMs on native ABO_1373 isolated from A. borkumensis grown under various conditions. Phosphoproteomic analysis might reveal regulatory phosphorylation sites in response to environmental signals. Site-directed mutagenesis of predicted modification sites, followed by functional assays, would establish their physiological significance. Additionally, comparative analysis of PTMs between recombinantly expressed and native proteins would inform the biological relevance of in vitro studies .

What purification strategies yield highest purity of ABO_1373?

Purification of membrane proteins like ABO_1373 requires specialized approaches. A comprehensive purification strategy should begin with optimized membrane fraction isolation using differential ultracentrifugation. The His-tagged protein can then be efficiently extracted using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG), which maintain membrane protein structure while solubilizing the lipid bilayer. Immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins represents the primary purification step, followed by size exclusion chromatography to remove aggregates and achieve homogeneity. Purity should be assessed via SDS-PAGE with confirmation by Western blotting, with acceptable purity exceeding 90% for structural and functional studies .

What structural characterization methods are appropriate for ABO_1373?

Due to its relatively small size (109 amino acids) and multiple membrane-spanning domains, ABO_1373 presents distinct challenges for structural characterization. Researchers should consider a multi-technique approach:

• Circular dichroism (CD) spectroscopy: Useful for determining secondary structure content (α-helices, β-sheets)

• Nuclear magnetic resonance (NMR): Potentially viable due to the protein's small size, requiring 15N/13C labeling

• X-ray crystallography: Challenging but possible, requiring specialized crystallization techniques for membrane proteins

• Cryo-electron microscopy: Increasingly viable for smaller proteins, especially if ABO_1373 forms higher-order complexes

Computational approaches including homology modeling and molecular dynamics simulations complement experimental methods, especially if structural templates from related UPF0060 family proteins exist in structural databases .

How can protein-protein interactions of ABO_1373 be effectively studied?

Identifying protein-protein interactions (PPIs) for membrane proteins requires specialized techniques that maintain the membrane environment. The following methodological approaches are recommended:

When interpreting results, researchers should be mindful of potential artifacts introduced by detergents, tags, or non-native expression systems .

How does ABO_1373 compare to other UPF0060 family proteins?

The UPF0060 protein family represents an uncharacterized group of membrane proteins found across diverse bacterial species. Comparative sequence analysis of ABO_1373 with other UPF0060 members reveals conserved motifs that may indicate functional regions. Conservation analysis should focus on transmembrane domains versus loop regions to identify potentially essential residues. Phylogenetic analysis placing ABO_1373 in evolutionary context with homologs from other hydrocarbon-degrading bacteria may reveal adaptation patterns. Researchers should combine sequence-based comparisons with structural predictions to generate functional hypotheses, followed by experimental validation through site-directed mutagenesis of conserved residues .

What biochemical assays can assess ABO_1373 functionality?

Without established knowledge of ABO_1373's specific function, researchers should employ multiple biochemical approaches to characterize its activities:

• ATPase/GTPase activity assays: To assess potential energy-coupled transport or signaling functions

• Lipid binding assays: Using fluorescently labeled lipids to test interactions with various hydrocarbons

• Ion flux measurements: In reconstituted proteoliposomes to test potential channel or transporter activity

• Substrate binding assays: Using thermal shift assays to screen potential ligands

• Redox activity tests: To evaluate possible roles in electron transport chains

Each assay should include appropriate positive and negative controls, and results should be interpreted in the context of A. borkumensis' metabolic capabilities, particularly its hydrocarbon degradation pathways .

How might ABO_1373 contribute to bioremediation applications?

A. borkumensis is recognized for its potential in oil spill bioremediation due to its hydrocarbon-degrading capabilities. If ABO_1373 participates in hydrocarbon metabolism pathways, its manipulation could enhance the bacterium's bioremediation efficiency. Research directions should include:

• Overexpression studies to determine if increased ABO_1373 levels enhance hydrocarbon degradation rates

• Structure-function studies to identify modifications that might improve substrate specificity or processing

• Comparative genomics across other bioremediation-relevant microorganisms to identify functional patterns

• Field testing of engineered strains under controlled conditions

Any genetic modifications should be carefully assessed for ecological impact before environmental applications. Researchers should also investigate ABO_1373's stability and function across the range of temperatures (4-35°C) and salinities (1-12.5%) where A. borkumensis naturally operates .

What biotechnological applications might exploit ABO_1373's properties?

Beyond bioremediation, ABO_1373's membrane protein characteristics could be valuable for various biotechnological applications:

• Biosensor development: If ABO_1373 interacts with specific hydrocarbons, it could be engineered into hydrocarbon detection systems

• Protein engineering platforms: As a small membrane protein, it might serve as a scaffold for designing novel membrane-associated functions

• Synthetic biology circuits: Integration into engineered bacteria for responsive detection of environmental pollutants

• Structural biology model: Its small size makes it a potential model system for membrane protein folding and stability studies

Development in these areas requires thorough characterization of the protein's structure, stability, and any natural ligand interactions. Researchers should emphasize rational design approaches based on structural insights and evolutionary conservation patterns .