Recombinant Alcelaphine herpesvirus 1 Envelope glycoprotein H (gH)

Shipped with Ice Packs
In Stock

Description

Glycoprotein H (gH) Function

Glycoprotein H is an envelope protein that plays a vital role in the entry of the virus into host cells . Studies on AlHV-1 have shown that gH, along with other viral proteins, is essential for the virus to spread efficiently in vivo and reach CD8+ T lymphocytes, which are crucial for inducing MCF .

gH and Malignant Catarrhal Fever (MCF)

AlHV-1 induces MCF, a fatal lymphoproliferative disease, in ruminants upon cross-species transmission . The pathogenicity of AlHV-1 is linked to its ability to infect and activate CD8+ T cells . Glycoprotein H is crucial for viral entry and spread, making it an important factor in the development of MCF .

gH and the gp115 Complex

gH is a component of the gp115 complex, which consists of five glycoproteins with molecular weights of 115, 110, 105, 78, and 48 kilodaltons (kDa) . All of these glycoproteins, except the 48-kDa species, react with antibodies in Western blots . The gp115 complex is significant because monoclonal antibodies that recognize it can neutralize virus infectivity, even without the presence of complement .

Recombinant Expression and Analysis of gH

Recombinant DNA technology allows for the production of gH in isolation, which can then be used to study its properties and functions. For example, a hemagglutinin-tagged version of AlHV-1 glycoprotein B (gB) was cloned and expressed to demonstrate that the AlHV-1-specific monoclonal antibody 12B5 recognized gB and that gB was the main component of the gp115 complex .

gH as a Vaccine Candidate

Due to its role in viral entry and its ability to induce neutralizing antibodies, gH is a potential candidate for vaccine development . Recombinant gB, another glycoprotein of AlHV-1, has potential as an antigen for ELISA detection of MCF virus infection and as a candidate vaccine antigen .

gH and Viral Spread

Studies have identified genes A7 and A8 of AlHV-1, which encode envelope glycoproteins, as essential for regulating viral spread . A7 appears to be involved in cell-to-cell viral spread, while A8 is necessary for cell-free viral propagation .

Post-translational Processing

Recombinant gB expressed by transfected HEK293T cells undergoes additional cleavage and incomplete post-translational processing compared to the native form of gB found in AlHV-1 virus particles . The native form of gB is detected as a band of about 70 kDa, while recombinant gB shows different processing patterns .

Table: Glycoproteins of AlHV-1 and Their Characteristics

GlycoproteinMolecular Weight (kDa)Role/Function
gHVariousPart of the gp115 complex, crucial for viral entry and spread
gB70 (native form)Main component of the gp115 complex, potential vaccine antigen
gp115 complex115, 110, 105, 78, 48Recognized by neutralizing antibodies

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
gH; 22; Envelope glycoprotein H; gH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-733
Protein Length
Full Length of Mature Protein
Species
Alcelaphine herpesvirus 1 (strain C500) (AlHV-1) (Malignant catarrhal fever virus)
Target Names
gH
Target Protein Sequence
ITTPAPPRPATTTPRRGVTSAPLIVPASSSELIVTLDGTFHSVTIDMTEIRQYVRQEIIE ALWNASHVFESLETTYNRYKDVYRFTDQSIRVNTRGKLSTCKEVNKSTEVSFYKSITSQT INGKYDGDLGISNHQLGQQLFFYVMNVFPVENAFYPVRKHVVYSSLSLADGAYQLAGMAT TNYVSLVVVRKISSTVTHEATIVFGNKKLLPSMRGSITKYDISLVNSDAEELLLLTSQKD YEYFSKNLFPQNWTDVFSLITSHTVGELAQILQTSVVDFARKGRCRSVHFNSHFLTTYLA VLSLYYKMGTEFVSKNERQISLQCILPKLYEANVCFDMVHRCFTSQYTRGFDSDGINRLS AAILGSMPFEPNQGLSVPTNWFLQTLYFVDGNLDPQNKGLHGITLILMDIYGRYVVNFTL TPEDRETLFYVYNALRGRKHLSTTMKNKYVSLIYCYTTSMCSATELAWGIEYWGEESTHS AHHSFSPCFMSLRFDYTLEKLNIEGSQDVKLTQTQLSNGVSAMYSLLTAKSSTWTIDSLS IKPCIYNASFVKMIVPFTNVSYVISQGVAAPGTTYDVAETFLKSSMVITVVSNSECYNLT ASKEILKIPVVYNMTHPRIKCQLCDSVVISYDEYDGLQTMVYISNYKVQQDLFSDYSIFF DFNNMHTHYLLLMNNGTLFEIRGLYANRAMNIIIILLFTIAALAGVFIVYKIVMYMTFK
Uniprot No.

Target Background

Function
The heterodimeric glycoprotein H-glycoprotein L complex is essential for the fusion of viral and host cell plasma membranes, enabling virus entry. Following initial receptor binding, membrane fusion is mediated by the fusion machinery comprising gB and the gH/gL heterodimer. gH/gL may also participate in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Database Links

KEGG: vg:911757

Protein Families
Herpesviridae glycoprotein H family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein.

Q&A

What is Alcelaphine herpesvirus 1 (AlHV-1) glycoprotein H and what is its role in viral infection?

AlHV-1 glycoprotein H (gH) is a conserved envelope glycoprotein encoded by ORF22 that plays a critical role in viral entry into host cells. As a member of the core herpesvirus fusion machinery, gH typically functions in complex with glycoprotein L (gL) and participates in membrane fusion events during viral entry.

Unlike glycoprotein B (gB), which undergoes furin cleavage as demonstrated by proteomic analysis , gH remains intact and contributes to:

  • Host cell receptor binding

  • Membrane fusion in conjunction with other glycoproteins

  • Potential regulation of cell tropism that may influence AlHV-1's ability to cause disease in cattle while remaining asymptomatic in wildebeest

In the context of AlHV-1 pathogenesis, gH likely contributes to the establishment of latent infection in CD8+ T cells, which is essential for MCF development as shown by recent research .

How do expression systems for recombinant AlHV-1 gH affect protein quality and research applications?

Multiple expression systems have been utilized for producing recombinant AlHV-1 gH, each offering distinct advantages and limitations:

Expression SystemAdvantagesLimitationsApplications
E. coli - High yield
- Cost-effective
- Well-established protocols
- No glycosylation
- Potential folding issues
- Often forms inclusion bodies
- Peptide epitope studies
- Antibody production
- Structural studies of domains
Yeast - Basic eukaryotic glycosylation
- Higher yields than mammalian cells
- Secreted protein production
- Non-native glycosylation patterns
- Potential hyperglycosylation
- Functional studies requiring some glycosylation
- Larger-scale protein production
Mammalian cells- Native-like glycosylation
- Proper protein folding
- Co-expression with gL possible
- Lower yields
- Higher cost
- Complex protocols
- Functional studies
- Cell binding assays
- Neutralization studies

The choice of expression system should be determined by the specific research application. For structural studies, bacterial systems may be sufficient for individual domains, while functional studies requiring native conformation would benefit from mammalian expression systems similar to those used for AlHV-1 gB expression in HEK293T cells .

What methodologies are recommended for purification and quality assessment of recombinant AlHV-1 gH?

Successful purification and quality assessment of recombinant AlHV-1 gH requires a multi-step approach:

Purification Strategy:

  • Affinity Chromatography: Using tags (e.g., His-tag as in commercial recombinant preparations ) for initial capture

  • Size Exclusion Chromatography: To remove aggregates and separate monomeric protein

  • Ion Exchange Chromatography: For removing contaminants with different charge properties

Quality Assessment Protocol:

  • Purity Analysis:

    • SDS-PAGE with >85% purity standard as indicated in product specifications

    • Western blotting using tag-specific or gH-specific antibodies

  • Identity Confirmation:

    • Mass spectrometry peptide mapping, similar to the approach used for AlHV-1 gB

    • N-terminal sequencing

  • Structural Integrity Assessment:

    • Circular dichroism to evaluate secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to verify correct folding

  • Functional Validation:

    • Cell binding assays

    • Protein-protein interaction studies with potential gL partners

The recombinant protein should be stored with 50% glycerol at -20°C/-80°C with minimized freeze-thaw cycles to maintain quality, as recommended for commercial preparations .

How can recombinant AlHV-1 gH contribute to understanding the pathogenesis of malignant catarrhal fever?

Recombinant AlHV-1 gH serves as a powerful tool for investigating MCF pathogenesis through multiple experimental approaches:

Viral Entry and Cell Tropism Studies:

  • Receptor Identification: Using labeled recombinant gH to identify binding partners on susceptible cells

  • Entry Inhibition Assays: Testing if anti-gH antibodies or soluble gH can block infection

  • Cell Type Susceptibility: Determining which cell types bind recombinant gH, potentially explaining the virus's tropism for CD8+ T cells

Host-Pathogen Interaction Analysis:

  • Differential Binding Studies: Comparing gH binding to cells from natural hosts (wildebeest) versus susceptible species (cattle)

  • Structure-Function Analysis: Mapping domains important for species-specific interactions

Comparative Virology:

  • Strain Comparison: Analyzing differences between pathogenic (C500) and attenuated AlHV-1 gH

  • Cross-Species Analysis: Comparing AlHV-1 gH with other MCF-causing viruses like OvHV-2

Latency Establishment:

  • Investigation of Initial Events: Determining if gH-mediated entry influences subsequent latent infection

  • T Cell Targeting: Exploring how gH contributes to the virus's ability to establish latency in CD8+ T cells, which is essential for MCF induction

These approaches could provide insights into why AlHV-1 causes fatal disease in cattle but not in its natural wildebeest host, potentially identifying new intervention targets.

What structural and functional relationships exist between AlHV-1 gH and other herpesvirus glycoproteins?

AlHV-1 gH shares structural and functional relationships with glycoproteins from other herpesviruses while maintaining unique characteristics:

Structural Comparisons:

  • Domain Organization: Like other herpesvirus gH proteins, AlHV-1 gH likely contains three conserved domains with specific functions in entry

  • Glycosylation Patterns: AlHV-1 gH contains predicted N-linked glycosylation sites that may differ from other gammaherpesviruses, potentially affecting receptor specificity

  • Transmembrane Region: Contains a typical C-terminal transmembrane domain followed by a short cytoplasmic tail

Functional Conservation:

  • Entry Complex Formation: Functions as part of the core entry machinery with gB and gL, similar to all herpesviruses

  • Fusion Regulation: Likely controls conformational changes in gB that drive membrane fusion, a conserved function across the herpesvirus family

Unique Features of AlHV-1 Glycoproteins:

  • MCF-Specific Glycoproteins: AlHV-1 encodes unique glycoproteins A7 and A8 that regulate viral spread

  • A7/A8 Interaction: These glycoproteins are orthologs of Epstein-Barr virus gp42 and gp350 , suggesting they may interact with gH during entry

  • Cell-to-Cell Spread: A7 mediates cell-to-cell spread while A8 is necessary for cell-free viral propagation

Understanding these relationships helps contextualize gH function within the broader viral entry process and may explain the unique pathogenesis of AlHV-1.

What techniques are most effective for studying AlHV-1 gH interactions with host cell receptors?

Investigating AlHV-1 gH-receptor interactions requires a comprehensive toolkit of biochemical, cellular, and biophysical techniques:

Protein-Protein Interaction Methods:

  • Surface Plasmon Resonance (SPR): Measures real-time binding kinetics between purified recombinant gH and potential receptors

  • Co-immunoprecipitation: Identifies host proteins that interact with gH, potentially using tagged recombinant gH as bait

  • Proximity Labeling: Utilizes techniques like BioID or APEX2 to identify proteins in close proximity to gH on the cell surface

Cell-Based Approaches:

  • Flow Cytometry: Similar to approaches used with AlHV-1 gB , fluorescently labeled recombinant gH can detect binding to different cell types

  • Fluorescence Microscopy: Visualizes gH localization and co-localization with potential receptors

  • Cell-Cell Fusion Assays: Measures fusion activity when gH is expressed with other viral glycoproteins

Genetic Screening:

  • CRISPR-Cas9 Screens: Identifies host factors required for AlHV-1 entry

  • cDNA Library Screening: Determines which human genes can confer susceptibility to gH binding in non-permissive cells

Structural Biology:

  • Cryo-Electron Microscopy: Visualizes gH-receptor complexes at near-atomic resolution

  • X-ray Crystallography: Determines precise binding interfaces between gH and receptor fragments

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Maps regions of gH that undergo conformational changes upon receptor binding

These approaches have successfully identified entry receptors for other gammaherpesviruses and can be adapted to study AlHV-1 gH, potentially explaining its species-specific pathogenicity.

How might recombinant AlHV-1 gH be utilized in vaccine development against malignant catarrhal fever?

Recombinant AlHV-1 gH offers multiple strategic opportunities for MCF vaccine development:

Subunit Vaccine Approaches:

  • Glycoprotein Combinations: Recombinant gH alone or combined with other viral glycoproteins (particularly gB, which has been identified as a potential vaccine antigen )

  • Rationally Designed Antigens: Structure-guided modifications to enhance immunogenicity or stability

  • Epitope-Focused Design: Identification and presentation of neutralizing epitopes from gH

Chimeric Virus Strategies:

  • Glycoprotein Exchange: Similar to the AlHV-1/OvHV-2 chimeric virus approach where AlHV-1 gB was replaced with OvHV-2 gB , gH could be exchanged to develop cross-protective vaccines

  • Attenuated Virus Platforms: Integration of modified gH into attenuated virus backbones, such as AlHV-1 ΔORF73, which fails to establish latency but can still replicate

Immunization Strategies:

  • Prime-Boost Protocols: DNA vaccines encoding gH followed by recombinant protein boosting

  • Adjuvant Optimization: Testing various adjuvant systems to enhance immune responses to recombinant gH

  • Delivery Systems: Nanoparticles, virus-like particles, or liposomes displaying gH

Safety and Efficacy Considerations:

  • Correlates of Protection: Establishing whether anti-gH antibodies correlate with protection

  • Cross-Protection: Determining if immunity against AlHV-1 gH provides protection against related MCF viruses

  • Duration of Immunity: Monitoring longevity of immune responses to recombinant gH formulations

The development of an effective MCF vaccine would benefit from comparative studies with the attenuated AlHV-1 strain that has lost pathogenicity through passage in culture , potentially identifying specific modifications to gH that contribute to attenuation while maintaining immunogenicity.

What methodological approaches can detect conformational changes in AlHV-1 gH during the viral entry process?

Studying the dynamic conformational changes of AlHV-1 gH during viral entry requires sophisticated techniques that can capture transient structural states:

Biophysical Methods:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Measures solvent accessibility changes in different regions of gH under various conditions

  • Single-Molecule FRET: Detects distance changes between fluorescently labeled regions of gH during conformational transitions

  • Electron Paramagnetic Resonance (EPR): Measures mobility and proximity changes in spin-labeled gH

Structural Biology Approaches:

  • Cryo-Electron Microscopy: Captures different conformational states of gH/gL complexes

  • Time-Resolved X-ray Structures: Obtains structures of gH at different stages of the fusion process

  • Small-Angle X-ray Scattering (SAXS): Monitors global conformational changes in solution

Biochemical Techniques:

  • Limited Proteolysis: Different conformational states expose different protease cleavage sites

  • Monoclonal Antibody Binding: Conformation-specific antibodies that recognize pre- or post-fusion states

  • Cross-linking Mass Spectrometry: Identifies regions that come into proximity during conformational changes

Computational Methods:

  • Molecular Dynamics Simulations: Models conformational transitions based on experimental structures

  • Normal Mode Analysis: Predicts intrinsic flexibility and potential conformational changes

These approaches could reveal how AlHV-1 gH transitions between pre-fusion and activated states, potentially identifying unique features that contribute to its role in MCF pathogenesis compared to other herpesvirus gH proteins.

How do genes A7 and A8 interact with AlHV-1 gH during viral entry and what are the implications for MCF pathogenesis?

The interaction between AlHV-1 gH and the unique glycoproteins encoded by genes A7 and A8 represents a critical aspect of viral pathogenesis with significant implications for MCF:

Functional Relationships:

  • Complementary Roles: Research has demonstrated that A7 mediates cell-to-cell spread while A8 facilitates cell-free viral propagation

  • Orthologs of EBV Proteins: A7 and A8 are orthologs of Epstein-Barr virus gp42 and gp350 , which regulate cell tropism switching

  • Essential for MCF: Both A7 and A8 are essential for the induction of MCF in experimental models

Mechanistic Interactions:

  • Entry Complex Formation: A7 and A8 may function alongside gH/gL during viral attachment and entry

  • Cell Type Specificity: The interaction between these glycoproteins may determine which cell types are infected

  • Conformational Regulation: A7/A8 might influence gH conformational changes during the entry process

Research Approaches to Study Interactions:

  • Co-immunoprecipitation: To detect physical associations between gH and A7/A8

  • Functional Complementation: Testing whether recombinant gH can restore function to viruses with A7/A8 mutations

  • Cross-linking Studies: Identifying proximity relationships between these proteins on the virion surface

Implications for MCF Pathogenesis:

  • Tissue Tropism: The interaction may explain the specific targeting of CD8+ T cells for latent infection

  • Species Specificity: Differences in receptor recognition by this glycoprotein complex might contribute to disease in cattle but not wildebeest

  • Therapeutic Targets: Disrupting these interactions could represent a novel intervention strategy

The proteomic analysis of virulent and attenuated AlHV-1 found that A8 was detected in virulent virus preparations but was absent from the attenuated virus , suggesting its importance in pathogenesis and highlighting the need to study its interaction with gH.

What role do post-translational modifications play in recombinant AlHV-1 gH function, and how can they be properly replicated in experimental systems?

Post-translational modifications (PTMs) critically influence AlHV-1 gH function, and replicating them correctly presents a significant challenge in recombinant expression systems:

Critical PTMs for gH Function:

Modification TypeFunctional ImportanceDetection Methods
N-linked Glycosylation- Proper folding
- Receptor binding
- Immune evasion
- PNGase F treatment
- Glycoproteomics
- Lectin binding assays
Disulfide Bonds- Structural stability
- Domain organization
- Conformational integrity
- Non-reducing SDS-PAGE
- Mass spectrometry
- Ellman's reagent
Proteolytic Processing- Unlike gB, gH is not cleaved by furin
- May undergo other site-specific processing
- N-terminal sequencing
- Western blotting
- Mass spectrometry
Lipid Modification- Membrane association
- Protein-protein interactions
- Metabolic labeling
- Lipidomics
- Detergent partitioning

Expression Systems for Proper PTMs:

  • Mammalian Expression Systems:

    • HEK293T cells (used for AlHV-1 gB ) provide native-like glycosylation

    • CHO cells offer robust production with human-like glycosylation

    • Limitations include lower yields and higher costs

  • Advanced Yeast Systems:

    • Glycoengineered Pichia pastoris strains with humanized glycosylation pathways

    • Achieves higher yields than mammalian cells with improved glycosylation

    • Represents a compromise between yield and modification quality

  • Insect Cell Systems:

    • Baculovirus expression with engineered insect cells for complex glycosylation

    • SweetBac technology for mammalian-type glycosylation

    • Offers higher yields than mammalian cells with reasonable glycosylation

Verification Approaches:

  • Glycoproteomic Analysis: Comparing recombinant gH glycosylation to virus-derived gH

  • Functional Assays: Testing receptor binding and fusion activity

  • Epitope Mapping: Using conformation-specific antibodies to verify proper folding

Understanding and replicating the correct PTMs on recombinant AlHV-1 gH is essential for studying its authentic function and developing effective vaccine candidates that present native epitopes to the immune system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.