Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9 (A9)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9 (A9) is a protein derived from the Alcelaphine herpesvirus 1 (AlHV-1) . AlHV-1 is a gammaherpesvirus that asymptomatically persists in wildebeests but causes malignant catarrhal fever (MCF) in other ruminants . A9 is a putative apoptosis regulator, which means it is theorized to play a role in controlling programmed cell death (apoptosis) .

Gene Information and Characteristics

The A9 protein is encoded by the A9 gene in the AlHV-1 virus . The full-length recombinant A9 protein consists of 168 amino acids . It is produced using recombinant DNA technology, where the A9 gene is inserted into a host organism (e.g., E. coli) to produce the protein . The recombinant A9 protein is expressed in E. coli . It is fused to an N-terminal His tag to facilitate purification and detection .

Function and Significance

The A2 gene of AlHV-1, which is distinct from A9 but relevant in the context of AlHV-1 function, is involved in the transcriptional regulation of immunological, cell cycle, and apoptosis pathways . Specifically, A2 influences γδ T cell receptor (TCR) expression and downregulates αβ TCR . It also affects TCR signaling, apoptosis, cell cycle, IFN-γ, and NFAT pathways . A2 enhances the expression of LGL cytotoxicity, which is implicated in causing endothelial and epithelial cell damage in multiple tissues, leading to the demise of animals with MCF .

Role in Malignant Catarrhal Fever (MCF)

AlHV-1 targets CD8+ T lymphocytes, leading to a deadly peripheral T cell lymphoma known as malignant catarrhal fever (MCF) . The virus maintains its genomes in T cells, causing transcriptomic and epigenomic changes in CD8+ T cells . Viral genes like A7 and A8 are essential for regulating viral spread and are required for AlHV-1 to efficiently spread in vivo, reach CD8+ T lymphocytes, and induce MCF .

Research Applications

Recombinant A9 protein is used in research for various purposes:

  • Studying Viral Pathogenesis: Understanding the role of A9 in the AlHV-1 life cycle and its contribution to the development of MCF .

  • Drug Discovery: Identifying potential antiviral targets and developing new therapeutic strategies against AlHV-1 infection .

  • Immunological Research: Investigating the immune responses to AlHV-1 and the mechanisms of viral immune evasion .

Related Research

The A2 gene of AlHV-1 is a member of the basic leucine zipper family of transcription regulator proteins . Several herpesviruses contain bZIP domain proteins phylogenetically related to A2 and O2, including MEQ of gallid herpesvirus-2, the bZLF1 proteins of HHV-4, and bZIP of macacine herpesvirus 5 . AlHV-1 infection in calves results in transcriptomic and epigenomic changes in CD8+ T cells . A viral membrane signaling protein drives T cell dysregulation and activation, clarifying MCF pathogenesis .

Experimental Data

ExperimentResults
A2 gene knockout in AlHV-1 infected rabbitsDelayed onset of MCF, but the disease still occurred, indicating A2 is not a critical virulence factor
RNAseq and qRT-PCR analysis in infected LGL T cellsA2 involved in transcriptional regulation of immunological, cell cycle, and apoptosis pathways; bias towards γδ T cell receptor expression
Cytotoxicity assays with A2ΔAlHV-1-infected LGLsSignificantly less cytotoxic compared to wtAlHV-1- and A2revAlHV-1-infected LGLs, implying A2 enhances LGL cytotoxicity
Viral DNA load post-mortem in rabbitsNo significant difference between A2ΔAlHV-1, wtAlHV-1, and A2revAlHV-1 infection groups, suggesting A2 does not affect viral DNA load in the MLNs of rabbits

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
A9; Putative apoptosis regulator A9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Alcelaphine herpesvirus 1 (strain C500) (AlHV-1) (Malignant catarrhal fever virus)
Target Names
A9
Target Protein Sequence
MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNS VEAPEPESLERIAKTLFTPRPHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCH IVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLLYFRTTQTK
Uniprot No.

Target Background

Function

This protein suppresses apoptosis in the host cell, thereby facilitating the production of progeny virions.

Database Links

KEGG: vg:911775

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the biological context of AlHV-1 A9 protein?

A9 is one of several viral proteins involved in regulating host-pathogen interactions. While A7 and A8 proteins regulate viral spread (with A7 involved in cell-to-cell spread and A8 in cell-free propagation), A9 specifically regulates apoptosis, which is critical for maintaining viral persistence in the host . The differential expression and function of these proteins likely contribute to the varying disease outcomes between natural hosts and susceptible species.

How is recombinant A9 protein produced and what are its specifications?

Recombinant AlHV-1 A9 protein is typically produced using bacterial expression systems. The specifications for commercially available recombinant A9 include:

ParameterSpecification
Expression SystemE. coli
Protein LengthFull length (1-168 amino acids)
TagN-terminal His tag
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDO36423

The production process involves cloning the A9 gene into an expression vector, expressing the protein in E. coli, and purifying it using affinity chromatography based on the His-tag . This approach yields high-purity protein suitable for various research applications.

How does A9 regulate apoptosis during AlHV-1 infection?

Based on structural homology and functional studies, A9 appears to regulate apoptosis through mechanisms similar to cellular Bcl-2 family proteins:

  • A9 contains a BH1 domain with the characteristic NWGR motif that is critical for anti-apoptotic function in Bcl-2 family proteins.

  • Experimental evidence indicates that A9 protects cells against cisplatin-induced apoptosis in vitro, suggesting interference with the intrinsic apoptotic pathway triggered by DNA damage .

  • Like other viral Bcl-2 homologs, A9 likely binds to and neutralizes pro-apoptotic BH3-only proteins, preventing mitochondrial outer membrane permeabilization and subsequent cytochrome c release.

  • This anti-apoptotic function likely contributes to viral persistence by preventing premature death of infected cells, allowing sufficient time for viral replication and spread .

Research on the specific molecular interactions and signaling pathways affected by A9 is ongoing, with particular interest in how these mechanisms differ between natural hosts and species susceptible to MCF.

What is the relationship between A9 and its homologs in other herpesviruses?

A9 shares significant homology with Ov9, a protein encoded by Ovine herpesvirus 2 (OvHV-2). Both proteins contain a solitary BH1 domain with an NWGR motif and function as anti-apoptotic regulators . This evolutionary conservation suggests their importance in the viral lifecycle.

The functional similarities between A9 and other viral Bcl-2 homologs extend to their role in maintaining chronic infection. Studies on other gammaherpesviruses, including Epstein-Barr virus (EBV) and Kaposi's sarcoma-associated herpesvirus (KSHV), have shown that their Bcl-2 homologs contribute to viral persistence and pathogenesis .

The availability of bacterial artificial chromosomes (BACs) for AlHV-1 provides valuable tools for investigating the extent to which the functions of A9 and its homologs are conserved across different gammaherpesviruses .

What are the optimal conditions for handling recombinant A9 protein?

For optimal handling and storage of recombinant A9 protein, researchers should follow these guidelines:

ParameterRecommendation
Initial StorageStore at -20°C/-80°C upon receipt
AliquotingNecessary for multiple use; avoid repeated freeze-thaw cycles
Short-term StorageWorking aliquots can be stored at 4°C for up to one week
ReconstitutionBriefly centrifuge vial before opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term StorageAdd 5-50% glycerol (final concentration) and store at -20°C/-80°C

Important notes:

  • Repeated freezing and thawing is not recommended as it can compromise protein stability and activity

  • The default final concentration of glycerol recommended is 50%

  • When preparing working solutions, consider adding protease inhibitors to prevent degradation

What experimental approaches can be used to study A9's anti-apoptotic function?

Multiple experimental approaches can be employed to investigate A9's anti-apoptotic function:

  • Cell Viability and Apoptosis Assays:

    • MTT/MTS assays to measure metabolic activity

    • Annexin V/PI staining to detect early apoptotic events

    • TUNEL assay to identify DNA fragmentation

    • Caspase activity assays using fluorogenic substrates

    • Western blotting for cleaved caspase-3 and PARP

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening

    • FRET/BRET assays to detect interactions in living cells

    • Surface plasmon resonance to measure binding kinetics

  • Functional Studies in Cell Culture:

    • Overexpression of A9 followed by apoptotic stimuli (e.g., cisplatin)

    • Comparison with known anti-apoptotic proteins (e.g., cellular Bcl-2)

    • Mutational analysis of key domains and residues

    • siRNA knockdown in virus-infected cells

  • Structural Studies:

    • X-ray crystallography or NMR spectroscopy

    • In silico modeling based on homology with other Bcl-2 family proteins

These approaches can be combined to provide a comprehensive understanding of A9's mechanism of action in preventing apoptosis .

How can researchers monitor A9 expression during viral infection?

Monitoring A9 expression during viral infection can be accomplished through several techniques:

  • Transcriptional Analysis:

    • RT-qPCR to quantify A9 mRNA levels

    • RNA-seq for genome-wide expression profiling

    • Northern blotting for detecting specific A9 transcripts

    • In situ hybridization to localize A9 mRNA in tissues

  • Protein Detection:

    • Western blotting using specific antibodies against A9

    • Immunofluorescence microscopy to visualize cellular localization

    • Flow cytometry for quantitative analysis at the single-cell level

    • Mass spectrometry-based proteomics for detailed protein characterization

  • Reporter Systems:

    • Generation of recombinant viruses expressing A9 fused to reporter proteins (e.g., GFP)

    • Development of A9 promoter-reporter constructs to study transcriptional regulation

  • Temporal Analysis:

    • Time-course experiments to track A9 expression during different phases of infection

    • Correlation with other viral and cellular events

Understanding the dynamics of A9 expression during infection can provide valuable insights into its role in the viral lifecycle and its relationship with other viral proteins like A7 and A8, which regulate viral spread .

What cell models are most appropriate for studying A9 function?

Selection of appropriate cell models is critical for studying A9 function:

Cell TypeApplicationRelevance
Bovine turbinate cellsViral propagation, cell-to-cell spreadNatural target cells in cattle
Bovine embryonic lung cellsViral replication studiesSupport AlHV-1 replication
CD8+ T lymphocytesLatency and transformation studiesTarget cells in MCF pathogenesis
Wildebeest-derived cellsComparative studiesCells from natural host
Rabbit cell linesMCF model studiesRabbits serve as experimental model for MCF

Important considerations:

  • Cell-free viral propagation and syncytia formation can be studied in bovine nasal turbinate and embryonic lung cell lines, as demonstrated in studies of A7 and A8 .

  • For studying CD8+ T cell infection and transformation, primary CD8+ T cells or established T cell lines from susceptible species would be most relevant to MCF pathogenesis .

  • Comparative studies using cells from both natural hosts (wildebeest) and susceptible species (cattle) can provide insights into species-specific differences in A9 function.

  • HEK293T or similar highly-transfectable cell lines may be useful for initial characterization of A9 functions in overexpression studies.

How does A9 function in the context of the complete viral genome?

A9 functions within a complex network of viral proteins that collectively regulate the AlHV-1 lifecycle:

  • Relationship with other viral proteins:

    • While A9 regulates apoptosis, A7 and A8 proteins regulate viral spread mechanisms

    • A7 appears to be involved in cell-to-cell viral spread

    • A8 facilitates viral cell-free propagation

  • Regulatory networks:

    • A9 expression may be regulated by viral transcription factors

    • In OvHV-2, the expression of Ov9 (A9 homolog) is regulated by RTA (replication and transcription activator) and Ov2

    • Similar regulatory mechanisms may exist for AlHV-1 A9, potentially involving A2 (homolog of Ov2)

  • Functional integration:

    • The combined functions of these proteins contribute to successful viral replication, spread, and persistence

    • Deletion of A7 or A8 prevents the development of MCF in rabbits, suggesting these genes are essential for reaching CD8+ T cells and inducing disease

Understanding these interactions provides a more comprehensive view of how AlHV-1 establishes infection, evades host defenses, and causes disease in susceptible species.

What are the implications of A9 research for understanding MCF pathogenesis?

Research on A9 has several important implications for understanding MCF pathogenesis:

  • Disease mechanism:

    • A9's anti-apoptotic function may contribute to the uncontrolled proliferation of infected CD8+ T cells characteristic of MCF

    • Prevention of apoptosis in infected cells could facilitate viral persistence and spread

  • Host-pathogen interaction:

    • Differences in A9 function or regulation between natural hosts and susceptible species might partly explain the divergent outcomes of infection

    • Understanding these differences could clarify why wildebeest remain asymptomatic while cattle develop fatal disease

  • Therapeutic potential:

    • A9 represents a potential target for therapeutic intervention

    • Inhibitors of A9's anti-apoptotic function might limit viral persistence and disease progression

    • Attenuation of A9 function could be explored for vaccine development

  • Comparative virology:

    • Similarities between A9 and anti-apoptotic proteins from other oncogenic herpesviruses suggest common mechanisms in virus-induced lymphoproliferative diseases

    • This connection is particularly relevant to other viruses causing lymphoproliferative diseases with similarities to MCF, such as those caused by New World primate herpesviruses in tamarins and marmosets

Further research on A9 will enhance our understanding of MCF pathogenesis and potentially lead to new strategies for prevention and treatment.

How can structural studies of A9 inform therapeutic development?

Structural studies of A9 can provide valuable insights for therapeutic development:

  • Structure determination:

    • X-ray crystallography of the 168-amino acid A9 protein would reveal its three-dimensional structure

    • Particular focus on the BH1 domain with the NWGR motif that is critical for anti-apoptotic function

    • Comparison with cellular Bcl-2 family proteins to identify unique features

  • Structure-function relationships:

    • Mapping of functional domains and critical residues

    • Understanding how A9 interacts with pro-apoptotic host proteins

    • Identification of potential binding pockets for small molecule inhibitors

  • Rational drug design:

    • Development of small molecules that specifically target A9's anti-apoptotic function

    • Design of peptide inhibitors that mimic BH3 domains to competitively bind A9

    • Creation of antibodies or other biologics that neutralize A9 function

  • Vaccine development:

    • Identification of immunogenic epitopes on A9 that could be targeted by vaccines

    • Engineering of attenuated viruses with modified A9 function

    • Development of subunit vaccines incorporating A9 or its immunogenic fragments

These approaches could lead to novel therapeutic strategies for preventing or treating MCF, which currently has no effective treatment or vaccine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.