Recombinant Alcelaphine herpesvirus 1 Uncharacterized gene 66 protein (66)

Shipped with Ice Packs
In Stock

Description

Genomic Structure and Composition

The genome of AHV-1 consists of a low GC content DNA (L-DNA) region of 130,608 bp with a low (46.17%) GC content and marked suppression of CpG dinucleotide frequency . The L-DNA is flanked by approximately 20 to 25 GC-rich (71.83%) high GC content DNA (H-DNA) repeats of 1,113 to 1,118 nucleotides, similar to herpesvirus saimiri .

Open Reading Frames (ORFs) and Homology

The analysis of the L-DNA sequence of AHV-1 revealed 70 open reading frames (ORFs), with 61 showing homology to other herpesviruses . These conserved ORFs are arranged in four blocks collinear to other Rhadinovirus genomes . The gene blocks are flanked by nonconserved regions containing ORFs without similarities to known herpesvirus genes .

Role in Malignant Catarrhal Fever (MCF)

AHV-1 causes malignant catarrhal fever (MCF) in susceptible species, including cattle, but infects its reservoir host, wildebeest, without causing disease . Pathology in cattle may be influenced by virus-host cell interactions mediated by the virus glycoproteins .

Viral Spread Regulation

AlHV-1 genes A7 and A8 are essential for regulating viral spread and suggest that AlHV-1 requires both genes to efficiently spread in vivo and reach CD8+ T lymphocytes and induce MCF . A7 appears to be involved in cell-to-cell viral spread, and A8 in viral cell-free propagation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
66; Uncharacterized gene 66 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Alcelaphine herpesvirus 1 (strain C500) (AlHV-1) (Malignant catarrhal fever virus)
Target Names
66
Target Protein Sequence
MPVMGCSVCSAFAELSRWAHGYPGGQTDAVAIEGDLWQLNLQILDVLEIDHASFVNFVFL GKGLTCIPWGTRGEFFTSWIQGLLERCSCPSVDIHKQLFYYGIYMCYFLTVYLLLYPSPV IIKYARSFFRGEQLWHLLCKFEWVIEKFMEYVFKINFNHPVIKINEGDLESYMFLRKKLK RQYLTPQLAVPPLFTRLPPSLQFIDEGHTHLDTHGEALASALKSCCEDVPCGSPFDSMVK NLALRCALSHQFSVIPVSDQSPNIVTQIREKILSISVLACVVRVPILSATVWSLVETKRP TFFVYCGECKHCLNFGKGKFLKVNFNPTHAFYCRDQKEKQCNVCATTGRIYCSFCGSADI HTASLTQMLDGVPIIRAVMANNAAFMLDTAQRSVDFILPCLGTHAKCEGSVLRRLSLLQL LYLTLNASELMCARCQS
Uniprot No.

Target Background

Database Links

KEGG: vg:911804

Protein Families
Herpesviridae UL49 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of AlHV-1 and how does it influence protein expression studies?

The AlHV-1 genome consists of a unique region of approximately 110-130 kilobases (kb) flanked by tandem repeat sequences totaling 30kb . This genomic organization resembles other gammaherpesviruses such as herpesvirus saimiri and herpesvirus ateles. The genome contains various open reading frames (ORFs) with different degrees of conservation among herpesviruses. Some ORFs are specific to AlHV-1, while others are shared with the gamma subfamily, beta+gamma subfamily, alpha+gamma subfamily, or are common to all herpesviruses .

When designing recombinant protein expression studies, researchers must consider this complex genomic structure, particularly the potential for genomic rearrangements that occur during the transition from virulence to attenuation in vitro. These rearrangements can affect the expression and function of viral proteins, potentially complicating interpretation of experimental results.

What expression systems are most effective for producing recombinant AlHV-1 proteins for research?

Based on established methodologies in AlHV-1 research, E. coli-based expression systems have been successfully employed for recombinant protein production. Specifically, thioredoxin fusion proteins have been used to express AlHV-1 ORFs, though with variable solubility outcomes . The research data indicates that:

  • Bacterial expression systems can produce sufficient quantities of recombinant AlHV-1 proteins for immunization purposes

  • Fusion partners such as thioredoxin (TrX) can improve protein expression and solubility

  • Purification methods including electroelution have been successfully applied to isolate recombinant AlHV-1 proteins for downstream applications

For proteins with poor solubility in bacterial systems, researchers might need to consider alternative expression platforms such as mammalian or insect cell systems, though these were not explicitly described in the available literature.

How can researchers generate and validate antisera against recombinant AlHV-1 proteins?

The generation of specific antisera against AlHV-1 proteins follows a methodical approach:

  • Expression of the target protein as a recombinant fusion protein (e.g., with thioredoxin) in E. coli

  • Purification of the recombinant protein using appropriate chromatography methods or electroelution

  • Immunization of rabbits with the purified recombinant protein

  • Collection and purification of antisera, typically using protein A-sepharose columns

Validation of the antisera specificity involves multiple methods:

  • Western blot analysis against the recombinant protein

  • Testing reactivity by SDS-PAGE and western blot

  • Confirming specific binding in immunofluorescence assays with infected cells

For example, in one study, antisera against ORF50, A6, and A7 proteins were generated and subsequently purified using protein A-sepharose columns. The purified IgG demonstrated specific reactivity with their respective recombinant proteins in western blot analyses .

What cell culture systems are most suitable for AlHV-1 propagation and protein expression studies?

Several cell types have been effectively used for AlHV-1 propagation and protein expression studies:

  • Bovine turbinate (BT) cells - commonly used for virus propagation and protein expression studies

  • Bovine thyroid cells and kidney cells

  • Bovine corneal cells

  • Bovine testes cells and adrenal cells

  • Rabbit kidney cells

The choice of cell system depends on the research objective. For virus isolation, co-culture of cells or oculo-nasal secretions from infected animals with permissive cell monolayer cultures is typically employed. The cytopathic effect (CPE) observed with cell-associated AlHV-1 is characteristically syncytial (formation of large multinucleate cells), while cell-free virus produces rounded refractile foci of infected cells .

For protein expression studies, bovine turbinate cells have been extensively used to study the expression patterns of viral proteins during different stages of infection.

How do genomic rearrangements at the right-hand end of the AlHV-1 genome affect protein expression during the virulence to attenuation transition?

The right-hand end of the AlHV-1 genome undergoes significant rearrangements during the transition from virulence to attenuation in vitro. Research findings indicate that these rearrangements affect the expression of several proteins, including those encoded by ORF50, A6, and A7 .

Data from experimental studies suggest that:

  • Virulent AlHV-1 maintains a specific genomic organization that supports the expression of certain proteins

  • Upon attenuation through extensive passage in bovine turbinate cells, genomic rearrangements occur

  • These rearrangements are more complex than initially thought and can affect the expression patterns of multiple proteins

The expression of ORF50 and A6, which share sequence homology with the Epstein-Barr virus (EBV) R and Z transactivators, appears to be maintained in large granular lymphocyte (LGL) cells, suggesting that virus replication occurs in these cells despite genomic rearrangements . This finding has important implications for understanding the molecular mechanisms of MCF pathogenesis.

What methods are most effective for detecting AlHV-1 protein expression in infected cells and tissues?

Detection of AlHV-1 protein expression in infected cells and tissues requires a multi-faceted approach:

  • Immunofluorescence antibody test (IFAT)

    • Utilizes specific antisera against recombinant viral proteins

    • Can detect protein expression in fixed infected cells

    • Allows visualization of protein localization within cells

  • Western blot analysis

    • Confirms protein expression and approximate molecular weight

    • Can be used to track protein expression over time during infection

    • Useful for comparing expression levels between different virus strains

  • Polymerase chain reaction (PCR)

    • Detects the presence of viral DNA in infected cells

    • Can be used to confirm the presence of specific viral genes

  • Reverse transcription PCR (RT-PCR)

    • Detects mRNA expression from viral genes

    • Confirms active transcription of viral genes in infected cells

For comprehensive analysis, researchers typically employ multiple methods in parallel. For example, in studies of ORF50, A6, and A7 expression, IFAT was used to detect protein expression while PCR and RT-PCR were employed to confirm the presence of viral DNA and mRNA, respectively .

How do recombinant AlHV-1 proteins contribute to understanding the pathogenesis of malignant catarrhal fever?

Recombinant AlHV-1 proteins serve as critical tools for elucidating MCF pathogenesis through multiple research approaches:

  • Generation of specific antisera

    • Allows detection of viral protein expression in infected cells and tissues

    • Helps track the temporal and spatial expression patterns during disease progression

  • Characterization of protein function

    • Identification of proteins involved in viral replication and pathogenesis

    • Understanding the role of specific viral proteins in cellular transformation

  • Investigation of host-pathogen interactions

    • Analysis of how viral proteins interact with host cellular machinery

    • Identification of cellular pathways disrupted by viral proteins

For example, studies with the A2 gene of AlHV-1, a member of the bZIP transcription factor family, revealed its role in transcriptional regulation of immunological, cell cycle, and apoptosis pathways . While A2 was not a critical virulence factor (as A2 knockout virus still caused MCF, albeit with delayed onset), it significantly affected T cell receptor expression patterns and cytotoxicity pathways in infected large granular lymphocytes .

What role do transcription factors encoded by AlHV-1 play in virus-host interactions and how can they be studied using recombinant proteins?

AlHV-1 encodes several proteins with transcription factor activity that play crucial roles in virus-host interactions:

  • A2 protein (bZIP transcription factor family)

    • Involved in transcriptional regulation of immunological pathways

    • Affects T cell receptor expression (biasing towards γδ TCR expression and downregulating αβ TCR)

    • Influences TCR signaling, apoptosis, cell cycle, IFN-γ, and NFAT pathways

    • Enhances cytotoxicity-associated pathways involving perforin and granzymes A and B

  • ORF50 and A6 proteins

    • Share sequence homology with EBV R and Z transactivators

    • Likely involved in viral replication in LGL cells

    • May play roles in the transition from latency to lytic replication

To study these transcription factors, researchers can:

  • Generate recombinant proteins for structural and functional analyses

  • Create gene knockout viruses to assess the role of specific transcription factors in pathogenesis

  • Perform differential gene transcription analysis (e.g., RNAseq) to identify host genes regulated by viral transcription factors

  • Conduct functional assays (e.g., cytotoxicity assays) to determine the biological effects of transcription factor activity

For example, knockout studies with A2 demonstrated its role in enhancing LGL cytotoxicity. A2ΔAlHV-1-infected LGLs were significantly less cytotoxic than wild-type and revertant virus-infected LGLs when tested against rabbit corneal epithelial cells .

What are the challenges in purifying recombinant AlHV-1 proteins with variable solubility, and what strategies can be employed to overcome them?

Purification of recombinant AlHV-1 proteins presents several challenges, particularly related to protein solubility:

  • Variable solubility profiles

    • Thioredoxin recombinant proteins encoded by ORF50, A6, and A7 demonstrated variable solubility in expression studies

    • Some proteins may form inclusion bodies in bacterial expression systems

  • Purification challenges

    • Insoluble proteins require denaturation and refolding protocols

    • Maintaining protein functionality during purification is critical for downstream applications

Strategies to overcome these challenges include:

  • Fusion tags

    • Thioredoxin fusion has been successfully used to improve solubility of some AlHV-1 proteins

    • Other solubility-enhancing tags (MBP, SUMO, GST) could be explored for problematic proteins

  • Alternative purification methods

    • Electroelution has been successfully employed to purify recombinant ORFA6-TrX and ORFA7-TrX proteins for rabbit immunization

    • Size exclusion chromatography and affinity chromatography can be optimized for specific proteins

  • Expression condition optimization

    • Lowering induction temperature

    • Modifying induction time and inducer concentration

    • Using specialized E. coli strains designed for improved protein folding

  • Alternative expression systems

    • Mammalian or insect cell expression systems for proteins that remain problematic in bacterial systems

    • Cell-free protein synthesis for toxic proteins

The research data indicates that despite solubility challenges, functional recombinant AlHV-1 proteins can be successfully produced and purified for immunological and functional studies .

How can gene knockout and revertant virus systems be designed to study AlHV-1 gene function in pathogenesis?

Gene knockout and revertant virus systems provide powerful tools for determining the functions of specific viral genes in pathogenesis. For AlHV-1, the following methodological approach has proven effective:

  • Generation of BAC clones

    • The creation of bacterial artificial chromosome (BAC) clones of the AlHV-1 genome stabilizes the viral genome and enables genetic manipulation

    • BAC cloning allows the deletion and insertion of genes that may be involved in virus pathogenesis

  • Gene knockout strategy

    • Target gene selection based on positional homology to known virulence genes in related herpesviruses

    • Precise deletion of the target gene while minimizing disruption to adjacent genes

    • Verification of knockout by PCR and sequencing

  • Revertant virus construction

    • Re-insertion of the deleted gene into the knockout virus

    • Generation of a proper control for knockout phenotypes

    • Ensures that observed phenotypes are due to the specific gene deletion rather than unintended genomic alterations

  • In vivo assessment

    • Infection of experimental animals (e.g., rabbits) with wild-type, knockout, and revertant viruses

    • Monitoring for disease development and progression

    • Comparison of disease parameters between groups

  • Ex vivo analyses

    • Isolation of infected cells from animals (e.g., LGL T cells)

    • Comparative analyses of cellular phenotypes and functions

    • Molecular analyses including transcriptomics and proteomics

This approach was successfully employed to study the role of the A2 gene in AlHV-1 pathogenesis, revealing that while A2 is not a critical virulence factor, it significantly influences host gene expression and cellular function during MCF .

What transcriptomic approaches are most informative for analyzing differential gene expression in AlHV-1-infected cells?

Transcriptomic analysis of AlHV-1-infected cells provides crucial insights into virus-host interactions and disease pathogenesis. The following approaches have proven most informative:

  • RNA sequencing (RNAseq)

    • Provides comprehensive, unbiased analysis of the entire transcriptome

    • Allows discovery of novel transcripts and splicing variants

    • Enables quantitative comparison between different experimental conditions

    • Was successfully employed to analyze differential gene expression in A2ΔAlHV-1-infected versus control LGLs

  • Quantitative reverse transcription PCR (qRT-PCR)

    • Validates findings from high-throughput transcriptomic analyses

    • Provides precise quantification of specific transcript levels

    • Useful for temporal analysis of gene expression

    • Was used to validate RNAseq findings in AlHV-1 research

  • Pathway analysis

    • Identifies biological pathways affected by viral infection

    • Reveals coordinated changes in gene expression

    • Helps interpret complex transcriptomic data

    • In AlHV-1 research, revealed effects on TCR signaling, apoptosis, cell cycle, IFN-γ, and NFAT pathways

  • Comparison between viral variants

    • Contrasting transcriptional profiles between wild-type, knockout, and revertant virus infections

    • Identifies gene expression changes attributable to specific viral genes

    • This approach identified A2-dependent changes in host gene expression

These transcriptomic approaches revealed that the A2 gene of AlHV-1 influences the expression of genes involved in T cell receptor signaling, cytotoxicity pathways (perforin and granzymes), and apoptosis regulation, providing important insights into MCF pathogenesis .

How can functional assays be designed to assess the biological effects of recombinant AlHV-1 proteins?

Designing effective functional assays for recombinant AlHV-1 proteins requires careful consideration of the protein's suspected function and relevant biological contexts:

  • Cytotoxicity assays

    • Measure the cytotoxic potential of infected cells against target cells

    • Can be performed using LGLs from AlHV-1-infected animals against appropriate target cells

    • Allow quantification of cell killing capacity

    • In A2 knockout studies, demonstrated reduced cytotoxicity of A2ΔAlHV-1-infected LGLs compared to wild-type controls

  • Immunofluorescence assays

    • Detect protein expression and localization in infected cells

    • Utilize specific antisera against recombinant viral proteins

    • Can track temporal and spatial expression patterns

    • Successfully employed to study ORF50, A6, and A7 expression in AlHV-1-infected BT cells

  • Transcriptional regulation assays

    • Assess the effect of viral transcription factors on host gene expression

    • Can employ reporter gene constructs to measure transcriptional activity

    • May include DNA binding assays to identify target sequences

    • Relevant for studying transcription factors like A2

  • Protein-protein interaction assays

    • Identify host cellular partners of viral proteins

    • Can include co-immunoprecipitation, yeast two-hybrid, or proximity ligation assays

    • Help elucidate mechanisms of viral protein function

    • Important for understanding how viral proteins interface with host cellular machinery

  • In vitro to in vivo correlation

    • Compare findings from in vitro functional assays with in vivo phenotypes

    • Establish relevance of protein functions to disease pathogenesis

    • Critical for understanding the biological significance of observed effects

These functional assays provide crucial insights into the biological roles of AlHV-1 proteins and their contributions to MCF pathogenesis.

How should researchers interpret contradictory data regarding AlHV-1 protein expression in different experimental systems?

When facing contradictory data regarding AlHV-1 protein expression across different experimental systems, researchers should employ a systematic approach to reconcile these discrepancies:

  • Consider biological context differences

    • Different cell types may support varying levels of viral gene expression

    • Temporal dynamics of infection may differ between systems

    • Compare expression in natural host cells versus experimental systems

    • The available data shows differences in AlHV-1 protein expression between bovine turbinate cells and LGL cell lines

  • Evaluate methodological variables

    • Sensitivity and specificity differences between detection methods

    • Variations in antibody affinities and detection thresholds

    • PCR primer efficiency and specificity

    • In AlHV-1 research, parallel detection methods (IFAT, PCR, RT-PCR) have been employed to provide complementary data

  • Account for viral strain variations

    • Genomic differences between laboratory-adapted and field isolates

    • Effects of passage history on genomic rearrangements

    • Research indicates that extensive passage of AlHV-1 leads to more complicated genome rearrangements than previously recognized

  • Utilize multiple detection methods in parallel

    • Combine protein-level (Western blot, IFAT) and nucleic acid-level (PCR, RT-PCR) detection

    • Cross-validate findings with independent methodologies

    • This approach was successfully used to study ORF50, A6, and A7 expression in MCF virus-infected cells

  • Consider the biological significance of quantitative differences

    • Determine whether observed differences reflect biologically meaningful variations or technical artifacts

    • Relate expression levels to functional outcomes

    • Studies of A2 function demonstrated that even when protein is expressed, its functional impact on cellular phenotypes can vary

By systematically addressing these factors, researchers can develop a more nuanced understanding of AlHV-1 protein expression patterns and their relevance to viral pathogenesis.

What statistical approaches are most appropriate for analyzing differential gene expression in AlHV-1 infection studies?

Appropriate statistical analysis is crucial for robust interpretation of differential gene expression data in AlHV-1 infection studies:

  • Normalization methods

    • Account for technical variations between samples

    • Options include RPKM/FPKM, TPM, or DESeq2 normalization

    • Critical for accurate comparison between experimental conditions

    • Should be selected based on experimental design and sequencing platform

  • Differential expression analysis

    • Tools such as DESeq2, edgeR, or limma for RNA-seq data

    • Appropriate for comparing gene expression between wild-type, knockout, and revertant virus infections

    • Accounts for biological variability and testing multiple hypotheses

    • Was applied in the analysis of A2-dependent transcriptional changes

  • Multiple testing correction

    • Control for false discovery rate (FDR) using methods such as Benjamini-Hochberg

    • Essential when testing thousands of genes simultaneously

    • Typically, an adjusted p-value threshold of 0.05 is used to identify significantly differentially expressed genes

  • Pathway enrichment analysis

    • Gene Set Enrichment Analysis (GSEA) or similar methods

    • Identifies coordinated changes in functionally related gene sets

    • More sensitive than individual gene analysis for detecting pathway-level changes

    • Revealed A2's involvement in regulating immunological, cell cycle, and apoptosis pathways

  • Validation of key findings

    • qRT-PCR confirmation of selected differentially expressed genes

    • Selection of validation targets based on biological significance and fold change

    • Correlation between RNA-seq and qRT-PCR results strengthens confidence in findings

    • This approach validated key transcriptional changes in A2ΔAlHV-1-infected cells

What emerging technologies could enhance our understanding of AlHV-1 protein functions in pathogenesis?

Several emerging technologies hold promise for advancing our understanding of AlHV-1 protein functions and their roles in pathogenesis:

  • CRISPR-Cas9 genome editing

    • More precise and efficient creation of viral gene knockouts

    • Generation of mutant viruses with specific point mutations rather than complete gene deletions

    • Introduction of reporter tags at endogenous loci to track protein expression

    • Could complement and extend the BAC-based approach used in A2 knockout studies

  • Single-cell RNA sequencing (scRNA-seq)

    • Analysis of transcriptional heterogeneity within infected cell populations

    • Identification of distinct cellular states during infection

    • Tracking of infection progression at single-cell resolution

    • Could provide insights into the variable responses of different cell subsets to AlHV-1 infection

  • Spatial transcriptomics

    • Mapping of gene expression changes within tissues while preserving spatial information

    • Correlation of viral protein expression with local host transcriptional responses

    • Understanding tissue-specific aspects of MCF pathogenesis

    • Particularly relevant given the multi-organ pathology of MCF

  • Proteomics approaches

    • Global analysis of protein expression and post-translational modifications

    • Identification of virus-induced changes in host proteome

    • Characterization of protein-protein interaction networks

    • Could complement transcriptomic findings from A2 knockout studies

  • Structural biology techniques

    • Determination of three-dimensional structures of key AlHV-1 proteins

    • Structure-based functional predictions

    • Rational design of inhibitors targeting specific viral proteins

    • Particularly relevant for transcription factors like A2

  • Organoid and tissue-on-chip technologies

    • More physiologically relevant models for studying virus-host interactions

    • Recapitulation of complex tissue environments

    • Potential for studying species-specific aspects of AlHV-1 infection

    • Could bridge the gap between cell culture and animal models

Integration of these emerging technologies with established approaches would significantly enhance our understanding of AlHV-1 pathogenesis and potentially reveal new targets for therapeutic intervention.

How might systems biology approaches contribute to a more comprehensive understanding of AlHV-1 pathogenesis?

Systems biology approaches offer powerful frameworks for integrating diverse datasets to develop a more comprehensive understanding of AlHV-1 pathogenesis:

  • Multi-omics integration

    • Combining genomics, transcriptomics, proteomics, and metabolomics data

    • Provides a more complete picture of virus-induced cellular changes

    • Reveals connections between different molecular processes

    • Could extend findings from transcriptomic studies of A2 function

  • Network analysis

    • Construction of gene regulatory networks affected by AlHV-1 infection

    • Identification of key regulatory hubs and network motifs

    • Prediction of master regulators driving pathological changes

    • Particularly relevant for understanding transcription factor-mediated effects like those of A2

  • Mathematical modeling

    • Dynamic models of virus-host interactions

    • Prediction of system behavior under different conditions

    • Identification of potential intervention points

    • Could help explain the delayed disease onset observed in A2ΔAlHV-1 infection

  • Comparative systems approaches

    • Systematic comparison of AlHV-1 with related herpesviruses

    • Identification of conserved and unique pathogenic mechanisms

    • Leveraging knowledge from better-studied viral systems

    • Meaningful given the positional homology between A2 and pathogenesis-related genes in other gammaherpesviruses

  • Host-pathogen interaction maps

    • Comprehensive catalogs of interactions between viral and host proteins

    • Identification of cellular pathways targeted by multiple viral factors

    • Understanding of cooperative effects between viral proteins

    • Could reveal how A2 interacts with other viral factors to enhance cytotoxicity

These systems biology approaches would facilitate a transition from studying individual viral proteins to understanding the integrated viral strategy for manipulating host cells and causing disease, potentially revealing new targets for therapeutic intervention in MCF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.