Recombinant Alcelaphine herpesvirus 1 Virion egress protein 69 (69)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NEC1; 69; Nuclear egress protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Alcelaphine herpesvirus 1 (strain C500) (AlHV-1) (Malignant catarrhal fever virus)
Target Names
NEC1
Target Protein Sequence
MHKIQKMSCTPSVRSRYTLKRKRLNSAKSATLKKKKVFLSNSEFFAGVSTNYELGKDFLR EMDTPICTSNTVFLPVKFSDVAPGRCLTLSPYGHSSVLGFHCQECKPDSSSGFTQAQQSA ESNELLSVNLCFLNNVEKVVQHKAFYLSLLGHSMNTVKQSLGQPSLLYCYTVLKKFYPQI FPIFTANGPMLTMYIIFTSLTLHVSEAVLRILTDNVENHNLSADCYKGHYILSIEPQALE ESNLNVCVTKICDLVAQLDFSDELKQEYVNGSTLIANFLN
Uniprot No.

Target Background

Function

This protein plays a crucial role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, it interacts with the newly formed capsid at its vertices, guiding it to the inner nuclear membrane through association with NEC2. It then induces capsid budding at the inner nuclear membrane and its subsequent envelopment within the perinuclear space. The protein complex (with NEC2) facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm for further processing at secondary budding sites in the Golgi apparatus or trans-Golgi network.

Database Links

KEGG: vg:911772

Protein Families
Herpesviridae NEC1 protein family
Subcellular Location
Host nucleus inner membrane.

Q&A

How does the AlHV-1 virion egress protein 69 interact with other viral proteins?

AlHV-1 virion egress protein 69 forms a complex with other viral proteins, particularly ORF67, which is analogous to the nuclear egress complex in other herpesviruses. This complex localizes to the nuclear membrane as demonstrated through live-cell analysis with fluorescent protein fusion experiments. The interaction between these proteins is critical for viral egress from the nucleus. Coexpression studies have shown that while ORF67 expression alone results in nuclear membrane reduplication, the addition of ORF69 leads to the formation of numerous virion-sized vesicles derived from the nuclear membrane .

What are the optimal conditions for recombinant expression of AlHV-1 virion egress protein 69?

Recombinant expression of AlHV-1 virion egress protein 69 has been successfully achieved in E. coli systems with N-terminal His-tagging. For optimal expression:

  • Use a bacterial expression system with a strong promoter (e.g., T7)

  • Express at temperatures between 25-30°C to improve protein folding

  • Include 6% trehalose in the storage buffer at pH 8.0

  • Purify using nickel affinity chromatography

  • For long-term storage, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles, which can damage protein integrity

What expression systems have been used to study the function of AlHV-1 virion egress protein 69?

Multiple expression systems have been utilized to study AlHV-1 virion egress protein 69:

  • E. coli systems: Primarily used for recombinant protein production for structural and biochemical studies

  • Insect cell systems: Baculovirus expression systems have been used for functional studies and protein-protein interaction analysis. This system has proven particularly useful for visualizing the effects of ORF69 expression on membrane structures

  • Mammalian cell systems: Used for studying the protein in a more native context

Research has demonstrated that insect cells infected with baculoviruses expressing ORF69 and its interaction partner ORF67 show distinctive membrane remodeling effects, making this a valuable system for studying the functional properties of these proteins .

How can I evaluate the membrane remodeling activity of AlHV-1 virion egress protein 69 in experimental settings?

To evaluate the membrane remodeling activity of AlHV-1 virion egress protein 69, researchers have employed several techniques:

  • Transmission Electron Microscopy (TEM): The gold standard for visualizing membrane alterations. In cells expressing both ORF67 and ORF69, TEM analysis revealed circular vesicles with a mean diameter of 146-157 nm derived from reduplicated nuclear membranes. Quantitative analysis showed that 88 out of 100 cells co-expressing both proteins displayed these vesicles .

  • Fluorescent Protein Fusion Imaging: By creating fusion proteins with fluorescent tags (GFP and mCherry), researchers can visualize the localization and interaction of ORF69 and ORF67 at the nuclear membrane in live cells.

  • Reconstitution of Venus Protein Fluorescence: This bimolecular fluorescence complementation assay can be used to confirm protein-protein interactions in cellular contexts.

  • Colocalization Assays: Using confocal microscopy to determine the precise subcellular localization of ORF69 and its interaction partners .

What controls should be included when studying the effects of ORF69 expression on cellular membranes?

When studying ORF69's effects on cellular membranes, include these essential controls:

  • Expression of ORF69 alone: This control shows that ORF69 by itself does not result in significant changes within the cell membrane structure.

  • Expression of ORF67 alone: This demonstrates that ORF67 results in nuclear membrane stacks/reduplication but does not produce the virion-size vesicles seen with co-expression.

  • Co-expression of ORF67 and ORF69: The experimental condition showing vesicle formation.

  • Quantification across multiple cells: Measure the frequency of membrane alterations (e.g., in one study, 89 out of 100 infected cells with ORF67 alone displayed nuclear membrane duplication, while 88 out of 100 cells with both proteins showed vesicle formation).

  • Size measurements of vesicles: To confirm they match virion dimensions (approximately 146-157 nm in diameter).

  • Time-course analysis: To determine the kinetics of membrane remodeling events following protein expression .

How does virion egress protein 69 contribute to AlHV-1 pathogenesis in susceptible species?

The virion egress protein 69 plays a critical role in AlHV-1 pathogenesis through several mechanisms:

It's worth noting that AlHV-1 causes malignant catarrhal fever (MCF) in cattle and other susceptible species, but not in its natural wildebeest host. The nuclear egress machinery may function differently in different host species, potentially contributing to this differential pathogenicity .

What is the relationship between ORF69 expression and the transition from virulent to attenuated AlHV-1?

The relationship between ORF69 expression and AlHV-1 attenuation is complex:

  • Virulence Attenuation: AlHV-1 becomes attenuated after extended passage in cell culture. Proteomic analysis comparing virulent and attenuated AlHV-1 found that most virion proteins, including components of the nuclear egress complex, are conserved between virulent and attenuated forms .

  • Structural Changes: Despite similar protein composition, subtle changes in protein conformation or post-translational modifications of ORF69 might contribute to attenuation, though direct evidence is limited.

  • Genomic Alterations: Attenuation is associated with genomic rearrangements. While specific changes to the ORF69 gene have not been directly implicated, alterations in other regions might affect ORF69 function indirectly .

  • Expression Regulation: Changes in expression levels or timing of ORF69 could contribute to attenuation. Analysis suggests that attenuation may be mediated through changes in expression of proteins not found in virions, such as transcription factors A6 or ORF50 .

The current evidence suggests that while gross changes in ORF69 are not the primary determinant of AlHV-1 attenuation, subtle changes in its expression, regulation, or interaction with other viral proteins might contribute to the attenuated phenotype .

How can AlHV-1 virion egress protein 69 be used as a target for antiviral drug development?

AlHV-1 virion egress protein 69 presents several advantages as a target for antiviral drug development:

  • Essential Function: As part of the nuclear egress complex, ORF69 performs an essential role in the viral life cycle. Inhibition of its function could effectively block viral replication.

  • Conserved Mechanisms: The nuclear egress mechanism is conserved across herpesviruses, suggesting that effective inhibitors might have broad-spectrum activity against multiple herpesvirus infections.

  • Unique Protein-Protein Interactions: The specific interaction between ORF69 and ORF67 could be targeted by small molecule inhibitors or peptide mimetics that disrupt this interaction.

  • Membrane Remodeling Activity: The unique ability of ORF69 to remodel membranes in conjunction with ORF67 offers a distinctive functional target.

Research approaches for drug development could include:

  • High-throughput screening assays using fluorescent protein fusions to identify compounds that disrupt ORF69-ORF67 interactions

  • Structure-based drug design targeting specific domains involved in protein-protein interactions or membrane association

  • Development of peptide inhibitors based on interaction interfaces

  • Cellular assays measuring inhibition of vesicle formation as a readout of drug efficacy

What are the challenges in studying protein-protein interactions involving AlHV-1 virion egress protein 69?

Studying protein-protein interactions involving AlHV-1 virion egress protein 69 presents several technical challenges:

  • Membrane Association: ORF69 is a membrane-associated protein, making it difficult to isolate in its native conformation for in vitro interaction studies.

  • Complex Formation Dynamics: The formation of the nuclear egress complex may involve multiple steps and conformational changes that are challenging to capture with static analytical methods.

  • Host-Specific Factors: Interactions may be influenced by host-specific factors that differ between the natural host (wildebeest) and susceptible species (cattle), complicating the interpretation of results from single-cell type studies.

  • Expression System Limitations: Different expression systems (bacterial, insect, mammalian) may result in different post-translational modifications or folding patterns, affecting protein-protein interactions.

  • Temporal Dynamics: The timing of interactions during the viral life cycle may be critical but difficult to synchronize in experimental systems.

Methodological approaches to overcome these challenges include:

  • Using baculovirus expression systems that have advantages over plasmid transfection in animal cells for studying membrane-associated proteins

  • Combining multiple complementary techniques (co-immunoprecipitation, fluorescence resonance energy transfer, proximity ligation assays)

  • Developing cell-free membrane systems that mimic the nuclear envelope environment

  • Time-course analyses with synchronized infections

How does AlHV-1 virion egress protein 69 compare to homologous proteins in other herpesviruses?

AlHV-1 virion egress protein 69 shares functional similarities with homologous proteins in other herpesviruses, though with some distinctive features:

HerpesvirusHomologous ProteinKey SimilaritiesKey Differences
Kaposi's sarcoma-associated herpesvirus (KSHV)ORF69Forms complex with ORF67; localizes to nuclear membrane; involved in vesicle formationPotentially different interaction specificities with host factors
Epstein-Barr virus (EBV)BFRF1 partnerNuclear membrane remodeling activityBFRF1 alone can cause membrane reduplication
Herpes simplex virus 1 (HSV-1)UL31Part of nuclear egress complex with UL34Different evolutionary adaptations in alphaherpesvirus vs. gammaherpesvirus lineages
Pseudorabies virus (PRV)UL31 orthologsFormation of virion-sized vesicles when co-expressed with partnerSpecies-specific adaptations

Research has shown that the phenotype of circular vesicle formation when co-expressing ORF67 and ORF69 was first reported in PRV orthologs and appears to be a common mechanism shared across different herpesviruses. The KSHV nuclear egress complex proteins have been extensively studied and show similar membrane remodeling properties to their AlHV-1 counterparts .

What evolutionary insights can be gained from studying AlHV-1 virion egress protein 69 across different viral strains?

Studying AlHV-1 virion egress protein 69 across different viral strains provides valuable evolutionary insights:

  • Conservation of Core Function: The nuclear egress mechanism is highly conserved across herpesviruses despite sequence divergence, suggesting strong evolutionary pressure to maintain this essential function.

  • Host Adaptation: Comparing ORF69 sequences from AlHV-1 strains adapted to different hosts (wildebeest vs. laboratory-adapted strains) may reveal host-specific adaptations in the nuclear egress machinery.

  • Virulence Determinants: Analysis of ORF69 in virulent vs. attenuated strains could identify specific residues or domains associated with efficient replication and pathogenesis. Proteomic analyses have shown that while most virion proteins (including ORF69) are conserved between virulent and attenuated forms, subtle differences may exist .

  • Recombination Events: Genomic studies of AlHV-1 have identified duplication and translocation events affecting other genes (e.g., ORF50 and A6). Similar events might have shaped the evolution of ORF69 in ancestral strains .

  • Interspecies Comparisons: Comparative analysis between AlHV-1 and related viruses like ovine herpesvirus 2 (OvHV-2) can highlight convergent or divergent evolutionary paths in nuclear egress mechanisms .

Understanding these evolutionary patterns could provide insight into how AlHV-1 has adapted to cause asymptomatic infection in its natural host while inducing fatal disease in other species .

What are the best approaches for detecting AlHV-1 virion egress protein 69 in infected tissues?

For detecting AlHV-1 virion egress protein 69 in infected tissues, several complementary approaches can be employed:

  • Immunohistochemistry/Immunofluorescence:

    • Develop specific antibodies against ORF69

    • Use formalin-fixed, paraffin-embedded (FFPE) or frozen tissue sections

    • Include appropriate controls (uninfected tissues, isotype controls)

    • Consider dual staining with markers for specific cell types to identify infected cell populations

  • In Situ Hybridization:

    • Design RNA probes specific to ORF69 mRNA

    • This technique has been successfully used for detecting expression of other AlHV-1 genes (e.g., A9.5) in MCF lesions

    • Can be combined with immunostaining to correlate mRNA expression with protein localization

  • Single-Cell RT-PCR:

    • Isolate cells from infected tissues

    • Perform RT-PCR to detect ORF69 transcripts

    • This approach has been used successfully for detecting other AlHV-1 genes in infected CD8+ T cells

  • Laser Capture Microdissection:

    • Isolate specific cells or lesions from tissue sections

    • Extract RNA or protein for targeted analysis of ORF69

  • Western Blotting of Tissue Lysates:

    • Prepare protein extracts from infected tissues

    • Use specific antibodies to detect ORF69

    • Include appropriate positive controls (recombinant protein) and negative controls

When designing these experiments, it's important to consider that AlHV-1 infection during MCF appears to be predominantly latent rather than productive, with limited viral gene expression. This may affect the detection sensitivity for structural proteins like ORF69 .

What quality control measures should be implemented when working with recombinant AlHV-1 virion egress protein 69?

When working with recombinant AlHV-1 virion egress protein 69, implement these quality control measures:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (aim for >90% purity)

    • Mass spectrometry to confirm protein identity and detect potential contaminants

    • Western blotting with anti-His tag antibodies and/or ORF69-specific antibodies

  • Structural Integrity:

    • Circular dichroism to assess secondary structure

    • Size-exclusion chromatography to detect aggregation

    • Dynamic light scattering to evaluate homogeneity and stability

  • Functional Validation:

    • Protein-protein interaction assays with known binding partners (e.g., ORF67)

    • Membrane binding assays if studying membrane remodeling properties

    • Activity assays relevant to the specific research question

  • Storage Stability:

    • Avoid repeated freeze-thaw cycles (prepare working aliquots at 4°C for up to one week)

    • Store at -20°C/-80°C in buffer containing 6% trehalose at pH 8.0

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

  • Batch Consistency:

    • Compare new batches to reference standards

    • Document lot-to-lot variation

    • Implement standardized production and purification protocols

  • Endotoxin Testing:

    • For applications involving cell culture or in vivo experiments

    • Use LAL (Limulus Amebocyte Lysate) assay or similar

  • Bioactivity Testing:

    • Develop application-specific functional assays

    • Compare activity to defined standards

What are promising research areas for understanding the structural basis of ORF69 function?

Several promising research directions could enhance our understanding of the structural basis of ORF69 function:

  • High-Resolution Structural Analysis:

    • X-ray crystallography of ORF69 alone and in complex with ORF67

    • Cryo-electron microscopy of membrane-bound complexes

    • NMR studies of specific domains involved in protein-protein interactions

  • Structure-Function Relationships:

    • Systematic mutagenesis of conserved residues to identify functional domains

    • Chimeric proteins with homologs from other herpesviruses to map species-specific functions

    • Truncation analysis to define minimal functional units

  • Membrane Interaction Dynamics:

    • Biophysical studies of how ORF69 interacts with and remodels lipid membranes

    • Lipid specificity for membrane binding and deformation

    • Real-time imaging of membrane remodeling processes

  • Interaction Networks:

    • Comprehensive identification of host factors that interact with ORF69

    • Mapping interaction interfaces at molecular resolution

    • Understanding how these interactions change during the transition from virulent to attenuated forms

  • Computational Approaches:

    • Molecular dynamics simulations of membrane interactions

    • Evolutionary analysis to identify conserved structural features

    • Virtual screening for potential inhibitors of ORF69 function

These approaches would significantly advance our understanding of how ORF69 contributes to viral egress and potentially inform the development of targeted antiviral strategies .

How might genome editing technologies be applied to study the function of AlHV-1 virion egress protein 69?

Genome editing technologies offer powerful approaches to study AlHV-1 virion egress protein 69 function:

  • CRISPR/Cas9 Editing of Viral Genomes:

    • Create precise mutations in ORF69 to study structure-function relationships

    • Generate conditional knockout systems to study temporal requirements

    • Introduce epitope tags for improved detection and purification

    • Create fluorescent protein fusions for live imaging studies

  • Bacterial Artificial Chromosome (BAC) Mutagenesis:

    • AlHV-1 has been cloned as an infectious BAC, facilitating genetic manipulation

    • Generate ORF69 deletion mutants to study loss-of-function phenotypes

    • Create point mutations to identify critical residues

    • Develop complementation systems to verify phenotypes

  • Recombination-Mediated Genetic Engineering:

    • Engineer recombinant viruses with modified ORF69 sequences

    • Create chimeric viruses with ORF69 from different herpesvirus species

    • Develop reporter viruses to monitor ORF69 expression and localization

  • Host Cell Engineering:

    • CRISPR knockout of potential host interaction partners

    • Creation of cell lines expressing modified forms of ORF69

    • Development of inducible expression systems to study temporal aspects

  • In Vivo Applications:

    • Generate transgenic animal models expressing AlHV-1 ORF69

    • Study tissue-specific effects of ORF69 expression

    • Test modified viruses in animal models of infection

A BAC clone of AlHV-1 has already been developed, making these approaches particularly feasible. These genetic tools could provide important insights into the role of ORF69 in both viral replication and pathogenesis .

What are common challenges in expressing and purifying AlHV-1 virion egress protein 69, and how can they be addressed?

Researchers commonly encounter these challenges when working with recombinant AlHV-1 virion egress protein 69:

  • Poor Solubility:

    • Problem: As a membrane-associated protein, ORF69 may have hydrophobic regions leading to aggregation.

    • Solutions:

      • Express as fusion protein with solubility enhancers (MBP, SUMO, thioredoxin)

      • Optimize buffer conditions (test different pH, salt concentrations)

      • Include mild detergents like 0.1% Triton X-100 or 0.5% CHAPS

      • Express truncated forms lacking hydrophobic domains

  • Low Expression Levels:

    • Problem: Viral proteins often express poorly in heterologous systems.

    • Solutions:

      • Codon optimization for expression host

      • Lower induction temperature (16-25°C)

      • Test different promoter strengths

      • Try different expression hosts (E. coli BL21(DE3), Rosetta, Arctic Express)

  • Protein Instability:

    • Problem: Recombinant ORF69 may be unstable after purification.

    • Solutions:

      • Include stabilizing agents (6% trehalose as used in commercial preparations)

      • Store in 5-50% glycerol at -20°C/-80°C

      • Avoid repeated freeze-thaw cycles

      • Add protease inhibitors during purification

  • Improper Folding:

    • Problem: Lack of proper folding can impact functional studies.

    • Solutions:

      • Express in eukaryotic systems for proper post-translational modifications

      • Include chaperones during expression

      • Test refolding protocols if expressing from inclusion bodies

  • Difficult Purification:

    • Problem: Membrane proteins can be challenging to purify to homogeneity.

    • Solutions:

      • Use tandem affinity tags

      • Implement multi-step purification strategies

      • Consider on-column refolding

      • Optimize imidazole concentrations for His-tagged proteins

What control experiments are essential when studying the effects of mutations in AlHV-1 virion egress protein 69?

When studying the effects of mutations in AlHV-1 virion egress protein 69, include these essential control experiments:

How can research on AlHV-1 virion egress protein 69 inform our understanding of membrane remodeling in other biological systems?

Research on AlHV-1 virion egress protein 69 offers valuable insights into membrane remodeling mechanisms with broader implications:

  • Vesicle Formation in Cellular Transport:

    • The ability of ORF69 to induce virion-sized vesicles parallels cellular vesicle formation processes

    • Understanding how ORF69 and ORF67 coordinate membrane deformation could inform models of ESCRT-dependent vesiculation or nuclear envelope breakdown during mitosis

  • Nuclear Envelope Dynamics:

    • Nuclear egress of herpesviruses resembles certain aspects of nuclear envelope remodeling during cellular processes like meiosis

    • Mechanisms of nuclear membrane breaching by viruses may inform understanding of nuclear envelope rupture in cancer cell migration

  • Membrane Curvature Mechanisms:

    • The molecular basis of how ORF69 induces membrane curvature could reveal general principles applicable to other membrane-deforming proteins

    • This knowledge could advance understanding of endocytosis, exocytosis, and organelle biogenesis

  • Lipid-Protein Interactions:

    • Studies of how ORF69 interacts with specific lipids could reveal principles of membrane domain organization

    • This has implications for understanding lipid rafts and membrane microdomains in cellular signaling

  • Bioengineering Applications:

    • The membrane-remodeling properties of ORF69 could potentially be harnessed for creating synthetic vesicles for drug delivery

    • Engineered versions might serve as tools for manipulating cellular membranes in research or therapeutic contexts

  • Evolutionary Conservation of Membrane Interactions:

    • Comparative studies across different viral nuclear egress complexes reveal conserved strategies for membrane manipulation

    • This evolutionary perspective informs broader understanding of how membrane-protein interactions have evolved

What implications does the study of AlHV-1 virion egress protein 69 have for understanding viral latency and pathogenesis?

The study of AlHV-1 virion egress protein 69 offers important implications for viral latency and pathogenesis:

  • Virus-Host Interface:

    • The nuclear egress complex represents a critical interface between viral replication and host nuclear architecture

    • Understanding how ORF69 interacts with host factors may reveal mechanisms by which AlHV-1 establishes different outcomes in natural versus susceptible hosts

  • Latency Establishment and Maintenance:

    • Although ORF69 is primarily involved in lytic replication, the regulation of nuclear egress may influence the balance between latent and lytic cycles

    • Research has shown that AlHV-1 infection during malignant catarrhal fever is predominantly latent rather than productive, with limited viral gene expression

    • The latency-associated nuclear antigen (LANA) encoded by ORF73 is essential for MCF induction, suggesting complex interplay between latency factors and structural proteins

  • Cell Type-Specific Effects:

    • AlHV-1 shows tropism for specific cell types, with high frequencies of infected CD8+ T cells during MCF

    • The nuclear egress machinery may function differently in different cell types, potentially contributing to cell type-specific pathogenesis

  • Immune Evasion:

    • Efficient nuclear egress mediated by ORF69 and partners may help the virus evade innate immune detection

    • The predominantly latent nature of infection during MCF suggests mechanisms for evading immune clearance

  • Therapeutic Targeting:

    • Understanding the role of ORF69 in viral egress provides potential targets for therapeutic intervention

    • Disrupting nuclear egress could potentially limit viral spread without triggering immune pathology associated with MCF

  • Comparative Virology:

    • Insights from AlHV-1 ORF69 can inform understanding of similar processes in related oncogenic gammaherpesviruses like Epstein-Barr virus and Kaposi's sarcoma-associated herpesvirus

This research highlights the complex relationship between viral structural proteins like ORF69 and the pathogenesis of AlHV-1, particularly the observation that MCF appears to be driven by latent infection rather than productive viral replication .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.