Recombinant Alces alces alces Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Introduction to MC1R

The Melanocortin-1 receptor (MC1R) belongs to the melanocortin receptors family, a group of G protein-coupled receptors that share 40-60% homology . MC1R functions primarily as a receptor for alpha-melanocyte-stimulating hormone (α-MSH) and is predominantly expressed in melanocytes, the specialized cells responsible for producing melanin pigments. In humans and other mammals, MC1R plays a central role in determining skin pigmentation, hair color, and skin tone .

MC1R has gained particular scientific attention due to its association with pigmentation phenotypes and potential links to melanoma susceptibility. In humans, mutations in the MC1R gene account for the red hair phenotype present in approximately 1-2% of the population, characterized by red hair, light skin, and poor tanning ability . These individuals typically have increased pheomelanin (red-yellow pigment) and reduced eumelanin (black-brown pigment) .

Molecular Architecture

MC1R is a G protein-coupled receptor (GPCR) characterized by seven α-helical transmembrane (TM) domains . The human MC1R consists of 317 amino acids, with expression levels of approximately 700 protein units on melanocytes and slightly higher amounts on melanoma cells . The receptor possesses several distinctive structural features:

  • An N-linked glycosylation site at the external N-terminus

  • A palmitoylation site at the intracellular C-terminus

  • A DRY motif at the junction of the third TM domain

Unlike most GPCRs, the melanocortin receptor subfamily has unique structural characteristics. The first and second extracellular domains lack one or two cysteines, while the fourth and fifth TM domains lack proline . The extracellular N-terminal tail serves as a signal anchor and plays a crucial role in ligand affinity, with a conserved cysteine residue at the intersection of the N-terminus and the first TM domain being essential for receptor function .

The C-terminus is involved in receptor interactions with G proteins at the plasma membrane and regulates protein trafficking from the endoplasmic reticulum to the plasma membrane. It also affects desensitization, internalization, and plasma membrane localization of the receptor .

Functional Domains

The intracellular and extracellular loops (ils and els) between the transmembrane domains contain conserved sequences shared with other melanocortin receptors. Despite being smaller than in most GPCRs, MC1R els are essential for constitutive basal signaling activity and affect binding affinity as they interact with ligands . Similarly, MC1R ils play crucial roles in Gs protein binding and contain phosphorylation sites that impact signal modulation, internalization, and receptor cycling .

Recent advancements using Cryo-electron microscopy have determined the structure of MC1R and MC1R-Gs complexes bound to various ligands, including α-MSH, afamelanotide, and SHU9119, providing important insights for targeted drug discovery .

Signaling Pathways

MC1R activation initiates several signaling cascades that regulate various cellular processes. The primary signaling pathway involves the following sequence:

  1. Binding of α-MSH to MC1R

  2. Activation of Gαs protein

  3. Stimulation of adenylate cyclase

  4. Enhanced cAMP production

  5. Activation of protein kinase A

  6. Phosphorylation of CREB (cAMP-responsive element-binding protein)

  7. Binding of phosphorylated CREB to the cAMP-responsive element of the microphthalmia transcription factor promoter

  8. Expression of MITF (microphthalmia transcription factor)

  9. MITF-mediated activation of genes involved in pigmentation and other cellular processes

This signaling cascade ultimately regulates melanogenesis, proliferation, and inhibition of apoptosis in melanocytes . The increased level of MC1R in the cell can enhance this cascade, creating a positive feedback loop .

Additionally, MC1R can signal through alternative pathways. MC1R activation can result not only in increased cAMP levels but also in transactivation of the stem cell growth factor receptor c-KIT, possibly via Src-kinase . This interaction leads to activation of extracellular-regulated kinases ERK1 and ERK2, connecting MC1R to the RAS/RAF/MEK/ERK signaling pathway . Interestingly, some MC1R variants associated with the red hair phenotype lose the ability to increase cAMP levels in response to hormonal stimulation but retain the capacity to activate ERK .

Table 2: Key Signaling Pathways Involving MC1R

PathwaySequenceOutcomes
cAMP Pathwayα-MSH → MC1R → Gαs → adenylate cyclase → cAMP → PKA → CREB → MITFMelanogenesis, cell proliferation, apoptosis inhibition
ERK PathwayMC1R → c-KIT → ERK1/2 activationCell proliferation, survival
PI3K/Akt PathwayMC1R-RHC → PI3K/Akt (in response to UV)Potential cancer-promoting effects
Anti-inflammatoryα-MSH → MC1R → cAMPReduction of inflammatory responses

Role in Pigmentation

The most well-characterized function of MC1R is its role in regulating melanin synthesis and pigmentation. Activation of MC1R by α-MSH promotes the production of eumelanin (black/brown pigment) over pheomelanin (red/yellow pigment) . Variants of the MC1R gene with reduced function lead to increased pheomelanin and decreased eumelanin, resulting in phenotypes such as red hair and fair skin .

Recent single-cell RNA sequencing studies of melanocytes from red hair color (RHC) mouse models have defined an MC1R-inhibited Gene Signature (MiGS) comprising previously unidentified genes potentially implicated in melanogenesis and oncogenic transformation . One candidate MiGS gene, TBX3, a transcription factor known to be involved in melanoma progression, has been shown to bind both E-box and T-box elements to regulate genes associated with melanogenesis and senescence bypass .

Association with Melanoma Susceptibility

MC1R function has been linked to melanoma risk through several mechanisms:

  1. Melanoma development involves a multi-step process of genetic mutations affecting cell proliferation, differentiation, and death, coupled with increased susceptibility to ultraviolet (UV) radiation .

  2. Research has demonstrated that the MC1R-RHC mutation promotes the PI3K/Akt signaling pathway when exposed to UV radiation . This pathway is well-known for its role in cancer development and has been implicated in breast, ovarian, and lung cancers .

  3. MC1R plays a key role in protecting melanocytes from UV-induced DNA damage, with variants having reduced protective capacity .

  4. MC1R expression levels affect melanoma cell migration capabilities, with higher expression associated with increased cell motility in some contexts . MC1R can decrease stress response activity by p38 MAPK kinase and increase the expression of syndecane-2, which is involved in enhancing melanoma cell motility .

At least 85 allelic variants of the MC1R gene have been identified, with certain mutations associated with both the red hair phenotype and increased melanoma risk . This genetic variability contributes to the diversity of human skin pigmentation and potentially to differential cancer susceptibility .

Comparative Studies

The Recombinant Alces alces alces MC1R protein provides researchers with a valuable tool for comparative studies across species. By examining structural and functional differences between MC1R proteins from different organisms, researchers can gain insights into:

  • Evolutionary adaptations in pigmentation systems

  • Species-specific signaling mechanisms

  • Differential responses to environmental factors such as UV radiation

  • Comparative analysis of MC1R-mediated pathways

These comparative studies can enhance our understanding of the fundamental biology of pigmentation and the evolutionary pressures that have shaped skin and hair color across different species.

Pharmacological Research

As a purified recombinant protein, Alces alces alces MC1R serves as an important reagent for pharmacological studies:

  • Screening of potential agonists and antagonists

  • Structure-activity relationship studies of melanocortin peptides

  • Development of selective MC1R modulators

  • Investigation of receptor-ligand interactions

These studies can contribute to the development of therapeutics targeting pigmentation disorders, potential melanoma treatments, and agents for reducing UV-induced skin damage.

Table 3: Research Applications of Recombinant Alces alces alces MC1R

Application CategorySpecific UsesPotential Outcomes
Comparative BiologyCross-species analysis, Evolutionary studiesUnderstanding pigmentation diversity, Identification of conserved domains
PharmacologyLigand screening, Structure-activity relationship studiesDevelopment of selective MC1R modulators, Therapeutic applications
Structural BiologyProtein structure determination, Conformational analysisInsights into receptor activation mechanisms, Drug design
Signaling StudiesPathway analysis, Protein-protein interactionsUnderstanding of MC1R-mediated cellular responses, Disease mechanism elucidation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate your request in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Alces alces alces (European moose) (Elk)
Target Names
Target Protein Sequence
MPVLGSQRRLLGSLNCTPPATFSLTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGALAARAAVVQQLDNVI DVLICGSMVSSLCFLGAIAMDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFI TYYNHTVVLLCLVGFFIAMLALMAILYVHMLARACQHARDIARLQKRQHPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
This receptor binds to melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins that activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by modulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does recombinant Alces alces alces MC1R differ from human MC1R?

Recombinant Alces alces alces (moose) MC1R shares core functional domains with human MC1R but exhibits species-specific variations in amino acid sequence that may influence ligand binding affinity and downstream signaling efficiency. These differences can be particularly relevant when using the recombinant protein as an experimental model. When conducting comparative studies, researchers should note that while the core tetrapeptide region critical for receptor binding and activation is generally conserved across mammalian species, the peripheral regions may show greater variability . These structural differences may translate to functional distinctions in ligand selectivity, signal transduction efficiency, and regulatory mechanisms. Experimental designs utilizing recombinant Alces alces alces MC1R should account for these potential species-specific characteristics when extrapolating findings to human systems.

What expression systems are optimal for producing recombinant MC1R?

Recombinant MC1R can be expressed in multiple host systems, each offering distinct advantages depending on research objectives. Common expression platforms include E. coli, yeast, baculovirus, and mammalian cell systems . For basic binding studies or antibody production, E. coli-expressed MC1R may be sufficient, though this system typically lacks post-translational modifications. For functional studies requiring properly folded and modified receptors, mammalian expression systems (typically HEK293 or CHO cells) are preferred as they provide the cellular machinery for appropriate post-translational modifications including palmitoylation, which is critical for MC1R function . Baculovirus expression systems offer a middle ground, providing some post-translational modifications with higher protein yields than mammalian systems. Selection of the optimal expression system should be guided by the specific experimental requirements, balancing protein yield, purity, and functional authenticity.

What methodologies are recommended for studying MC1R palmitoylation and its impact on receptor function?

MC1R palmitoylation is a critical post-translational modification that significantly impacts receptor function, particularly in relation to chromosome stability and centromeric integrity. To investigate this aspect, researchers can employ several complementary approaches. Palmitoylation can be experimentally manipulated using inhibitors such as 2-bromopalmitic acid (2-BrP) at concentrations around 50 μM . Differential effects can be observed by comparing cells with normal MC1R expression to those with silenced MC1R, particularly following UV exposure. Giemsa staining and metaphase spread chromosome analysis provide effective techniques for assessing cytogenetic alterations resulting from palmitoylation inhibition . When designing such experiments, it's important to include appropriate controls such as α-MSH (10 μM) stimulation to activate MC1R signaling. For quantitative assessment, researchers should document specific chromosomal abnormalities including lagging chromosomes and anaphase bridges during cell division. This methodological approach allows for direct correlation between MC1R palmitoylation status and chromosomal stability under various experimental conditions.

How can researchers effectively measure MC1R-mediated signaling in experimental systems?

MC1R signaling can be monitored through multiple downstream pathways, with cAMP being a primary second messenger. For quantitative assessment, researchers can employ cAMP assays following receptor stimulation with α-MSH or other melanocortin peptides. Additionally, phosphorylation of downstream targets can be measured via Western blotting or phospho-specific ELISAs. MITF transcriptional activity, a key downstream effect of MC1R activation, can be assessed using reporter gene assays or by measuring expression levels of MITF target genes . When designing signaling experiments, it's important to include appropriate time course analyses, as MC1R signaling dynamics may vary depending on the specific pathway being examined. Melanocyte cell lines or primary melanocytes with manipulated MC1R expression (either silenced or overexpressed) provide valuable model systems. For more sophisticated analyses, researchers can employ biosensors for real-time monitoring of cAMP or calcium flux in response to receptor activation. These approaches collectively provide a comprehensive assessment of MC1R signaling capacity and efficiency.

What are the critical quality control parameters for recombinant MC1R preparations?

Quality control for recombinant MC1R preparations should assess multiple parameters to ensure experimental reliability. Purity should be confirmed via SDS-PAGE, with recombinant preparations typically achieving ≥85% purity . Functional integrity can be evaluated through ligand binding assays using labeled α-MSH or synthetic agonists. For G protein-coupled signaling assessment, cAMP accumulation assays following receptor stimulation provide valuable functional data. Thermal stability testing helps determine optimal storage conditions and handling protocols. When working with transmembrane proteins like MC1R, detergent selection for solubilization is critical—inappropriate detergents can disrupt receptor structure and function. Mass spectrometry can verify the presence of expected post-translational modifications or identify potential contaminants. For recombinant preparations intended for structural studies, circular dichroism spectroscopy provides information about secondary structure integrity. These quality control measures collectively ensure that recombinant MC1R preparations maintain their structural and functional properties, enabling reliable experimental outcomes and reproducible research findings.

How can researchers investigate the role of MC1R in chromosome stability and centromere integrity?

Investigating MC1R's role in chromosome stability requires sophisticated cytogenetic approaches. Based on established methodologies, researchers should implement metaphase spread analysis with Giemsa staining to visualize chromosomal abnormalities in melanocytes with manipulated MC1R expression . This can be complemented with fluorescence in situ hybridization (FISH) using centromere-specific probes to assess centromeric integrity. UV irradiation protocols (typically 100 J/m² UVB) should be standardized to ensure reproducible DNA damage induction . Experimental designs should include MC1R silencing via siRNA or CRISPR-Cas9, alongside α-MSH stimulation to activate the receptor in control cells. The appearance of specific abnormalities—lagging chromosomes, anaphase bridges, and fragmented centromeres—should be quantified across multiple fields and experiments. For mechanistic insights, researchers can simultaneously manipulate MITF expression, as this transcription factor appears to mediate some of MC1R's protective effects on chromosome stability . Real-time imaging of labeled centromeric proteins during cell division provides additional dynamic information about how MC1R signaling affects chromosome segregation. These methodological approaches collectively enable detailed characterization of MC1R's contribution to maintaining genomic integrity under both normal and UV-stressed conditions.

What experimental designs best elucidate the relationship between MC1R variants and melanoma outcomes?

To investigate associations between MC1R variants and melanoma outcomes, researchers should implement multi-layered experimental designs combining clinical data analysis with molecular mechanistic studies. Large-scale survival analyses adjusting for known prognostic factors (as employed in the BioGenoMEL collaborative study) represent a foundational approach . When designing such studies, researchers should categorize MC1R variants appropriately, distinguishing between consensus (wild-type) alleles and variant alleles with potentially different functional impacts. Hazard ratios with 95% confidence intervals should be calculated to quantify survival effects . These clinical findings can be complemented with laboratory investigations examining how specific MC1R variants affect cellular responses to DNA damage, apoptosis resistance, and proliferation rates in melanoma cell lines. For comprehensive assessment, transcriptomic and proteomic profiling of melanoma cells expressing different MC1R variants provides insights into altered signaling networks. Animal models with humanized MC1R variants offer in vivo validation platforms. This integrated approach—combining population-level survival data with cellular and molecular mechanistic studies—enables robust evaluation of how MC1R genetic variation influences melanoma progression and patient outcomes.

How does MC1R signaling interact with MITF to regulate melanocyte function and melanoma biology?

The interaction between MC1R signaling and MITF represents a critical regulatory axis in melanocyte biology and melanoma development. To experimentally dissect this relationship, researchers should implement gene silencing and overexpression approaches targeting both MC1R and MITF in primary melanocytes or melanoma cell lines . Chromatin immunoprecipitation (ChIP) assays can identify MITF binding sites in genes related to melanocyte function and survival. Stimulation with α-MSH activates the MC1R signaling cascade, which can be monitored through phosphorylation of CREB and subsequent changes in MITF expression and activity. When designing experiments to investigate this interaction, it's essential to assess how MC1R-mediated signaling affects MITF's transcriptional targets involved in pigmentation, DNA repair, cell cycle regulation, and apoptosis. Research has shown that MITF overexpression can rescue chromosomal instability in melanocytes with silenced MC1R, suggesting that MITF mediates MC1R's protective effects on genomic integrity . Quantitative PCR and Western blotting provide straightforward methods for measuring changes in gene and protein expression, while more sophisticated approaches like RNA-seq and ChIP-seq offer genome-wide perspectives on how MC1R signaling modulates MITF-dependent transcriptional programs. These methodological approaches collectively illuminate the complex interplay between these two master regulators of melanocyte biology.

What are the optimal methods for evaluating binding kinetics of ligands to recombinant MC1R?

Evaluation of ligand binding kinetics to recombinant MC1R requires specialized techniques that provide quantitative data on association and dissociation rates. Surface plasmon resonance (SPR) represents a gold standard approach, allowing real-time, label-free detection of binding interactions. For SPR experiments with MC1R, the recombinant receptor should be immobilized on sensor chips using appropriate chemistry that preserves protein orientation and functionality. Alternatively, competitive binding assays using radiolabeled or fluorescently tagged α-MSH or synthetic agonists provide quantitative binding parameters including Ki values . When designing binding experiments, it's important to include positive controls (such as native α-MSH) and negative controls to ensure assay specificity. Temperature control is critical as binding kinetics can vary significantly with temperature. For G protein-coupled receptors like MC1R, binding assays in lipid environments rather than detergent solutions may better represent native receptor conformations. Data analysis should yield association (kon) and dissociation (koff) rate constants in addition to equilibrium dissociation constants (KD), providing a complete kinetic profile of ligand-receptor interactions. These methodological considerations ensure reliable and reproducible binding data that can inform structure-activity relationships and drug development efforts.

How can researchers effectively analyze the impact of MC1R on DNA repair mechanisms?

To analyze MC1R's impact on DNA repair mechanisms, researchers should implement multi-parameter experimental designs that directly measure DNA damage and repair efficiency. UV irradiation protocols should be standardized, typically using UVB at doses around 100 J/m² . Cyclobutane pyrimidine dimers (CPDs) and 6-4 photoproducts can be quantified using specific antibodies via immunofluorescence or ELISA-based methods to assess initial damage levels. Repair kinetics can be monitored by measuring the persistence of these DNA lesions at defined time points post-irradiation. Comet assays provide a complementary approach for measuring DNA strand breaks. When designing such experiments, it's essential to compare cells with normal MC1R expression to those with silenced or variant MC1R, with and without α-MSH stimulation. For mechanistic insights, researchers should examine the recruitment of DNA repair proteins to damaged sites using chromatin immunoprecipitation or fluorescence microscopy with time-lapse imaging. Gene expression analysis focusing on nucleotide excision repair pathway components can reveal how MC1R signaling modulates the DNA repair machinery at the transcriptional level. These methodological approaches collectively provide a comprehensive assessment of how MC1R signaling influences cellular responses to DNA damage and the efficiency of repair processes.

What are the future research directions in MC1R biology and its applications?

Future MC1R research will likely expand in several promising directions, integrating advanced technologies to address fundamental questions. Single-cell approaches will provide unprecedented insights into heterogeneity of MC1R expression and signaling within melanocyte populations and melanoma tumors. Structural biology techniques, including cryo-electron microscopy, will elucidate the three-dimensional architecture of MC1R in complex with various ligands and signaling partners, potentially revealing new druggable pockets. Gene editing technologies will enable precise modification of MC1R and interacting proteins in relevant cell types and animal models, allowing for detailed functional characterization. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics will map comprehensive signaling networks downstream of MC1R activation. Therapeutic applications represent another frontier, with MC1R-targeted interventions potentially protecting against UV-induced DNA damage or modulating inflammatory responses. Additionally, comparative studies across species, including analysis of Alces alces alces MC1R, may reveal evolutionary adaptations in receptor function related to environmental pressures. These diverse research directions will collectively advance our understanding of MC1R biology and potentially translate into novel preventive or therapeutic strategies for melanoma and other conditions involving MC1R signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.