Recombinant Alginate biosynthesis sensor protein kinB (kinB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kinB; Alginate biosynthesis sensor protein KinB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Pseudomonas aeruginosa
Target Names
kinB
Target Protein Sequence
MSMPLPMKLRTRLFLSISALITVSLFGLLLGLFSVMQLGRAQEQRMSHHYATIEVSQQLR QLLGDQLVILLRETPDGQALERSQNDFRRVLEQGRANTVDSAEQAALDGVRDAYLQLQAH TPALLEAPMVDNDGFSEAFNGLRLRLQDLQQLALAGISDAETSARHRAYLVAGLLGLVGV AILLIGFVTAHSIARRFGAPIETLARAADRIGEGDFDVTLPMTNVAEVGQLTRRFGLMAE ALRQYRKTSVEEVLSGERRLQAVLDSIDDGLVIFDNQGRIEHANPVAIRQLFVSNDPHGK RIDEILSDVDVQEAVEKALLGEVQDEAMPDLVVDVAGESRLLAWSLYPVTHPGGHSVGAV LVVRDVTEQRAFERVRSEFVLRASHELRTPVTGMQMAFSLLRERLDFPAESREADLIQTV DEEMSRLVLLINDLLNFSRYQTGMQKLELASCDLVDLLTQAQQRFIPKGEARRVSLQLEL GDELPRLQLDRLQIERVIDNLLENALRHSSEGGQIHLQARRQGDRVLIAVEDNGEGIPFS QQGRIFEPFVQVGRKKGGAGLGLELCKEIIQLHGGRIAVRSQPGQGARFYMLLPV
Uniprot No.

Target Background

Function
Recombinant Alginate biosynthesis sensor protein KinB (KinB) is a member of the two-component regulatory system AlgB/KinB, involved in regulating alginate biosynthesis genes. KinB functions as a membrane-associated protein kinase, phosphorylating AlgB in response to environmental signals.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is KinB and what is its fundamental role in alginate biosynthesis?

KinB is a histidine protein kinase that functions as part of a two-component regulatory system in Pseudomonas aeruginosa and related species. It serves as the cognate sensor kinase for the response regulator AlgB, which is involved in alginate production . Most significantly, KinB acts as a negative regulator of alginate biosynthesis in wild-type mucA strains of P. aeruginosa .

In its functional state, KinB undergoes autophosphorylation and transfers the phosphoryl group to AlgB . The protein has a molecular weight of approximately 66 kDa and contains conserved domains characteristic of histidine protein kinases . KinB's regulatory activity affects the expression of alginate biosynthetic genes, particularly through the algD promoter, which controls the operon responsible for alginate production .

How is the kinB gene organized in relation to other alginate-related genes?

The kinB gene is located immediately downstream of algB in the Pseudomonas aeruginosa genome . This genetic organization reflects their functional relationship in the two-component regulatory system. While algB is required for high-level alginate production, kinB has been shown to negatively regulate this process in wild-type mucA strains .

The alginate biosynthetic gene cluster in P. aeruginosa is organized as an operon with transcription initiating at the algD promoter and includes genes such as alg8, alg44, algG, algX, algL, algF, and algA . Although kinB is not part of this primary operon, its regulatory activity significantly impacts the expression of these genes, demonstrating the complex regulatory network controlling alginate biosynthesis .

What experimental methods are commonly used to detect and measure KinB activity?

Several methodological approaches have been validated for studying KinB activity:

  • Autophosphorylation assays: Using purified C-terminal KinB protein and [γ-32P]ATP to observe progressive autophosphorylation in vitro .

  • Phosphotransfer assays: Measuring the transfer of phosphoryl groups from phosphorylated KinB to purified AlgB .

  • Reporter gene fusions: Western blot analysis of strains carrying kinB-lacZ protein fusions to analyze KinB localization and expression .

  • Membrane localization studies: Using kinB-phoA fusions to confirm inner membrane localization of KinB and identify its periplasmic domain .

  • Mutagenesis approaches: Generating specific mutations in conserved residues of KinB to assess their effects on autophosphorylation activity .

  • Alginate quantification: Measuring alginate production in wild-type and kinB mutant strains to assess the regulatory impact of KinB .

What is the mechanism by which KinB negatively regulates alginate production?

KinB negatively regulates alginate production through a complex mechanism involving the AlgU signal transduction pathway . In wild-type mucA P. aeruginosa strains, inactivation of kinB causes overproduction of alginate through the following mechanism:

  • In the absence of functional KinB, there is increased expression from the algU promoters (PalgU) .

  • This leads to elevated levels of the alternative sigma factor AlgU, which is normally sequestered by the anti-sigma factor MucA .

  • KinB inactivation increases the rate of MucA degradation through an AlgW-dependent proteolytic pathway .

  • The degradation of MucA releases AlgU, allowing it to direct RNA polymerase to transcribe alginate biosynthetic genes .

  • This process requires the response regulator AlgB and the alternative sigma factor RpoN (σ54), although interestingly, AlgB does not need to be phosphorylated to promote alginate production in kinB mutants .

The experimental evidence shows that when kinB is inactivated, there is higher expression from both PalgD and PalgU promoters, indicating that KinB normally suppresses these promoters in wild-type cells .

How does the KinB-AlgB two-component system interact with the AlgU-MucA regulatory pathway?

The interaction between the KinB-AlgB two-component system and the AlgU-MucA regulatory pathway represents a sophisticated regulatory network:

  • Signal transduction hierarchy: KinB functions upstream of the AlgU-MucA regulatory system . When KinB is inactivated, it triggers a cascade that ultimately leads to MucA degradation and AlgU release .

  • AlgB dependency: Although AlgB is the cognate response regulator for KinB, the AlgW-mediated degradation of MucA in kinB mutants requires AlgB . This suggests that AlgB plays a dual role - both as the phosphorylation target of KinB and as a mediator in the regulated proteolysis of MucA .

  • RpoN requirement: The alternative sigma factor RpoN (σ54) is also required for AlgW-mediated MucA degradation in kinB mutants . This is noteworthy because RpoN is not always required for alginate synthesis in mucA mutant strains .

  • Phosphorylation independence: While KinB can phosphorylate AlgB, this phosphorylation is not necessary for alginate production when kinB is inactivated . This indicates that unphosphorylated AlgB can still function in promoting alginate synthesis under certain conditions .

The experimental data supporting these interactions comes from genetic studies where deletion of rpoN or algB in kinB mutants decreased alginate production to wild-type nonmucoid levels, and expression of phosphorylation-defective AlgB.D59N restored mucoidy in the kinB algB double mutant .

What is the relationship between KinB and MucA degradation in alginate regulation?

The relationship between KinB and MucA degradation represents a critical regulatory mechanism:

  • Inactivation of kinB leads to increased degradation of MucA, as demonstrated by experiments with HA-tagged MucA .

  • This degradation is mediated by the DegS-like protease AlgW, as inactivation of algW in kinB mutants causes loss of alginate production and accumulation of HA-MucA .

  • The AlgW-mediated MucA degradation in kinB mutants specifically requires both algB and rpoN .

  • These findings suggest that KinB normally functions to suppress the proteolytic degradation of MucA, thereby preventing the release of AlgU and subsequent activation of alginate biosynthesis genes .

This provides evidence for a model where KinB acts as a negative regulator of the AlgU signal transduction pathway by protecting MucA from degradation, either directly or indirectly through the modulation of AlgB and RpoN activities .

How can researchers generate and characterize kinB mutants for alginate studies?

Researchers can employ several methodological approaches to generate and characterize kinB mutants:

Generation of kinB mutants:

  • Insertional mutagenesis: Using transposons to disrupt the kinB gene .

  • Targeted gene deletion: Creating clean deletion mutants using allelic exchange vectors .

  • Site-directed mutagenesis: Introducing specific mutations in conserved residues to study structure-function relationships .

Characterization approaches:

  • Phenotypic analysis: Assessing colony morphology for mucoidy, which indicates alginate overproduction .

  • Quantitative alginate measurement: Using carbazole assay or other biochemical methods to quantify alginate production .

  • Promoter activity assessment: Measuring expression from alginate-related promoters (PalgD and PalgU) using reporter gene fusions .

  • Protein expression analysis: Western blotting to detect levels of regulatory proteins and assess MucA degradation .

  • Complementation studies: Introducing wild-type or mutant versions of kinB to assess restoration of phenotype .

When creating double or triple mutants (e.g., kinB algB, kinB algW), researchers should consider the potential for synthetic phenotypes and ensure appropriate controls are included to distinguish direct from indirect effects .

What are the optimal conditions for studying KinB autophosphorylation and phosphotransfer to AlgB in vitro?

For effective in vitro studies of KinB autophosphorylation and phosphotransfer to AlgB, researchers should consider the following methodological approach:

Protein preparation:

  • Generate a C-terminal KinB derivative containing the kinase domain, as the full-length protein with transmembrane domains may be difficult to purify in active form .

  • Express recombinant proteins with appropriate tags (His-tag, GST-tag) for purification .

  • Purify AlgB separately using affinity chromatography to obtain the phosphorylation target .

Autophosphorylation assay conditions:

  • Reaction buffer: Typically Tris-HCl (pH 7.5-8.0) with MgCl2 and KCl .

  • ATP source: [γ-32P]ATP for radioactive detection of phosphorylation .

  • Incubation: Room temperature or 30°C for 5-30 minutes to observe progressive autophosphorylation .

  • Analysis: SDS-PAGE followed by autoradiography or phosphorimaging .

Phosphotransfer assay:

  • First autophosphorylate KinB as described above .

  • Add purified AlgB to the reaction mixture .

  • Incubate for short time intervals (30 seconds to 5 minutes) to capture the transfer kinetics .

  • Analyze by SDS-PAGE and detect the transfer of phosphoryl label from KinB to AlgB .

Controls:

  • Include KinB variants with mutations in conserved histidine residues that should abolish autophosphorylation .

  • Test phosphorylation-defective AlgB (e.g., AlgB.D59N) that cannot accept the phosphoryl group .

These experimental conditions have been validated in previous studies demonstrating KinB autophosphorylation and phosphotransfer to AlgB .

How does the function of KinB in alginate regulation differ between mucA mutant strains and wild-type mucA strains?

The function of KinB in alginate regulation shows important distinctions between mucA mutant and wild-type strains:

In wild-type mucA strains:

  • KinB functions as a negative regulator of alginate production .

  • Inactivation of kinB leads to overproduction of alginate through AlgW-mediated degradation of MucA .

  • This process requires both algB and rpoN .

  • The effect is mediated through increased expression at both PalgD and PalgU promoters .

In mucA mutant strains:

  • KinB is not required for alginate production in mucA22 mutant strains .

  • Since MucA is already defective in these strains, AlgU is constitutively released, rendering the negative regulatory role of KinB irrelevant .

  • The AlgB response regulator is still required for alginate production in mucA mutants, but it functions independently of KinB .

This differential requirement highlights the context-dependent nature of KinB's regulatory function and suggests that multiple regulatory pathways control alginate production, with the KinB-AlgB pathway being particularly important in wild-type mucA strains .

How do the roles of KinB compare between Pseudomonas aeruginosa and other alginate-producing bacteria like Azotobacter vinelandii?

The regulatory roles of KinB show important similarities and differences across bacterial species:

In Pseudomonas aeruginosa:

  • KinB functions as a negative regulator of alginate biosynthesis in wild-type mucA strains .

  • It forms a two-component system with AlgB, capable of phosphorylating AlgB, though this phosphorylation is not required for alginate regulation when kinB is inactivated .

  • KinB's regulatory effect is mediated through the AlgU-MucA pathway and involves AlgW-dependent proteolysis of MucA .

In Azotobacter vinelandii:

  • While the AlgB response regulator homolog exists in A. vinelandii, research suggests it may not be necessary for alginate production in this organism .

  • A. vinelandii produces alginate constitutively, unlike Pseudomonas species where biosynthesis is activated only under certain environmental conditions .

  • The regulatory network in A. vinelandii appears to be distinct, with studies indicating that truncated AlgB proteins may retain sufficient function to support alginate synthesis .

In Pseudomonas syringae:

  • The arrangement of alginate structural genes is similar to P. aeruginosa, but the regulatory mechanisms may differ .

  • Complementation analyses indicate that the structural gene clusters in P. aeruginosa and P. syringae are not functionally interchangeable when expressed from their native promoters .

These comparisons highlight the evolutionary divergence in alginate regulation systems across species and suggest that while core components may be conserved, their functional interactions and regulatory importance can vary significantly .

What experimental approaches can be used to identify environmental signals sensed by KinB?

Identifying environmental signals sensed by KinB requires sophisticated experimental designs:

In vivo approaches:

  • Environmental condition screening: Systematically testing alginate production in wild-type and kinB mutant strains under various conditions (oxygen levels, nutrient availability, pH, osmolarity) .

  • Periplasmic domain analysis: Creating chimeric sensors by fusing the periplasmic domain of KinB with reporter proteins to detect binding of potential signal molecules .

  • Site-directed mutagenesis: Targeting residues in the periplasmic domain predicted to be involved in signal sensing and measuring the impact on KinB function .

  • In vivo crosslinking: Using photoactivatable crosslinkers to capture interactions between the periplasmic domain and potential signal molecules.

In vitro approaches:

  • Direct binding assays: Purifying the periplasmic domain of KinB and testing its binding affinity for candidate signal molecules using techniques like isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR).

  • Structural studies: Determining the three-dimensional structure of the periplasmic domain using X-ray crystallography or NMR to identify potential binding pockets.

  • Autophosphorylation modulation: Testing if candidate signal molecules can modulate the autophosphorylation activity of purified KinB in vitro .

Research has shown that alginate expression in P. aeruginosa increases under anaerobic conditions, suggesting oxygen limitation might be one signal affecting this regulatory system . Additionally, conditions present in cystic fibrosis lungs may influence KinB activity, as P. aeruginosa chronic infections in these patients often lead to mucoid conversion .

How might targeting KinB function be exploited for therapeutic interventions in Pseudomonas infections?

Targeting KinB function represents a promising therapeutic approach for Pseudomonas infections:

Therapeutic rationales:

  • Reducing virulence: Since alginate overproduction contributes to biofilm formation and antibiotic resistance in P. aeruginosa infections, enhancing KinB's negative regulatory function could potentially reduce alginate production and virulence .

  • Biofilm disruption: Manipulating KinB signaling might destabilize established biofilms, increasing bacterial susceptibility to antibiotics and host immune responses .

  • Preventing mucoid conversion: In cystic fibrosis lung infections, targeting pathways that lead to mucoid conversion could help prevent the establishment of chronic infections .

Potential therapeutic strategies:

  • Small molecule modulators: Developing compounds that stabilize KinB in its active conformation, enhancing its negative regulation of alginate production.

  • Peptide inhibitors: Designing peptides that mimic the interaction surfaces between KinB and AlgB to disrupt their signaling.

  • Targeted proteolysis: Exploiting the AlgW-mediated proteolytic pathway to increase MucA stability and prevent AlgU release .

  • Combinatorial approaches: Using KinB modulators in conjunction with conventional antibiotics to increase efficacy against biofilm-associated infections.

Research considerations:

  • Specificity challenges: Ensuring therapeutic agents specifically target KinB without affecting human kinases or beneficial bacteria.

  • Delivery methods: Developing effective delivery systems, particularly for reaching bacteria within biofilms.

  • Resistance mechanisms: Investigating potential compensatory pathways that might bypass KinB regulation.

These approaches require further research into the structural details of KinB-AlgB interactions and the precise mechanisms of KinB sensing and signaling .

What are the key considerations when interpreting conflicting data about KinB function across different experimental systems?

When facing conflicting data about KinB function, researchers should consider:

Strain-specific variations:

  • Genetic background differences: The function of KinB may vary based on the genetic background of the strain used (PAO1 vs. clinical isolates) .

  • mucA status: Results may differ dramatically between wild-type mucA and mucA mutant strains .

  • Secondary mutations: Laboratory strains may accumulate secondary mutations affecting KinB function or alginate regulation.

Experimental condition variables:

  • Growth conditions: Differences in media composition, oxygen availability, and growth phase can significantly impact KinB function and alginate production .

  • In vitro vs. in vivo studies: KinB behavior in purified systems may not fully reflect its function in the cellular context .

  • Measurement methods: Different methods for quantifying alginate production may yield varying results .

Analysis approach:

  • Create a standardized comparison table: Systematically document experimental conditions, strain backgrounds, and methodologies alongside results to identify patterns in conflicting data.

  • Perform validation experiments: When encountering conflicts, validate key findings using multiple methodological approaches.

  • Consider physiological relevance: Determine which experimental system most closely mimics the physiological context of interest (e.g., cystic fibrosis lung environment) .

  • Genetic complementation: Use complementation studies with wild-type and mutant alleles to confirm phenotype specificity .

The literature shows specific examples of contextual dependencies, such as phosphorylation of AlgB not being required for PalgD activation, yet KinB's role differs between wild-type mucA and mucA22 mutant strains .

How should researchers design experiments to differentiate direct versus indirect effects of KinB on alginate biosynthesis?

Designing experiments to distinguish direct from indirect KinB effects requires methodical approaches:

Temporal analysis strategies:

  • Inducible expression systems: Use tightly controlled inducible promoters to express or inhibit KinB and track immediate versus delayed responses in alginate biosynthesis .

  • Time-course experiments: Monitor changes in gene expression, protein levels, and alginate production over time following KinB activation or inactivation .

  • Pulse-chase degradation studies: Track MucA degradation rates in response to KinB perturbation to establish causality .

Molecular interaction analyses:

  • Direct binding assays: Use techniques like chromatin immunoprecipitation (ChIP) to determine if AlgB directly binds to alginate biosynthesis gene promoters .

  • Protein-protein interaction studies: Employ co-immunoprecipitation, bacterial two-hybrid, or FRET approaches to identify direct interaction partners of KinB .

  • In vitro reconstitution: Attempt to reconstitute key aspects of the regulatory pathway with purified components to establish direct relationships .

Genetic approaches:

  • Epistasis analysis: Construct and analyze double and triple mutants (e.g., kinB algW, kinB algB rpoN) to establish the hierarchy of genetic interactions .

  • Targeted domain mutations: Create specific mutations that affect particular functions of KinB (e.g., autophosphorylation, phosphotransfer, signal sensing) to dissect its direct roles .

  • Suppressor screens: Identify mutations that suppress the mucoid phenotype of kinB mutants to reveal additional components of the pathway .

The current literature demonstrates the value of this approach, showing that AlgW-mediated MucA degradation requires both algB and rpoN in the kinB mutant, establishing an indirect regulatory pathway from KinB to alginate production through these intermediaries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.