Recombinant Alicyclobacillus acidocaldarius subsp. acidocaldarius Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Overview of SecF in the Sec Translocase System

SecF is a core component of the SecDF complex, which operates alongside the SecYEG channel and SecA ATPase to facilitate protein translocation across bacterial membranes . The Sec translocase system is universally conserved and essential for transporting secretory proteins post-translationally. In Alicyclobacillus acidocaldarius, an extremophile thriving in acidic, high-temperature environments, SecF plays a role in stabilizing membrane dynamics under stress .

Functional Role of SecF

  • Post-Translational Translocation: SecDF (comprising SecD, SecF, and YajC) uses the proton motive force (PMF) to complete translocation after SecA’s ATP-driven activity .

  • Regulation of SecA Cycling: SecDFyajC stabilizes the membrane-inserted form of SecA, preventing backward movement of preproteins and enabling PMF to drive forward translocation .

  • Stress Adaptation: In A. acidocaldarius, SecF contributes to thermoacidophilic resilience by interacting with membrane lipids and maintaining structural integrity under extreme conditions .

Research Applications and Findings

  • Mechanistic Studies: SecF’s interaction with SecYEG and SecA has been reconstituted in vitro, revealing its role in stabilizing translocation intermediates .

  • Thermostability: The ω-cyclohexane fatty acids in A. acidocaldarius membranes enhance SecF’s function under high temperatures, making it a model for extremophile adaptations .

  • Genetic Conservation: Homologs of SecF are present in diverse bacteria, including Accumulibacter spp., where they share 97–99% sequence identity .

Genomic and Metabolic Context

  • Genomic Features: The A. acidocaldarius DSM 446 genome (3.2 Mbp, 61.9% GC) includes 3,153 protein-coding genes, with 32% of unknown function .

  • Sulfur Metabolism: Unlike some Alicyclobacillus strains, SecF-producing isolates lack nitrate reduction genes but possess cysP for sulfate uptake, linking SecF to sulfur assimilation .

Future Directions

  • Structural Resolution: Cryo-EM studies could elucidate SecF’s role in PMF coupling.

  • Industrial Applications: Exploiting SecF’s thermostability for bioengineering heat-resistant protein export systems.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; Aaci_2101; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / JCM 5260 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-1A) (Bacillus acidocaldarius)
Target Names
secF
Target Protein Sequence
MKPRFDIIRASRWFFLLSGAITVAGVIVFALFGFNLSTDFKSGSEVQFELNQRVPEARVR QMFASIGLPLGDTSLTVGGIQQNVVMVTLPEQLTAKQISEIQAAEHRFFPDAKQDIQVNS VDPFVAEQTARKAVYAVLAAAACIVVYIAIRFEFRFAISGIIALLHDAFIVLAAFALLRR EVDLTFVAALLTIVGYSINDTIVIFDRIRENLKIDKPETVDELRAVVNKSLWQVMNRSIR TVLTVLIAAVILYFFGGISIRNFTFALIIGLVSGAYSSIFIASPIWVAWRSRSMKKATRG DKAAPIPE
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant SecF protein during experimental procedures?

For optimal stability and activity of recombinant Alicyclobacillus acidocaldarius SecF protein:

  • Store stock solutions at -20°C for routine storage

  • For extended preservation, store at -20°C or -80°C in a Tris-based buffer containing 50% glycerol

  • Working aliquots can be maintained at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • The protein is typically provided in a stabilized buffer optimized for its specific characteristics

This careful storage protocol is essential for maintaining protein functionality in structural and functional assays typical of academic research.

What growth conditions are optimal for culturing Alicyclobacillus acidocaldarius for SecF expression studies?

When designing experimental protocols for SecF expression in native Alicyclobacillus acidocaldarius:

ParameterOptimal ConditionTolerable RangeInhibitory Conditions
Temperature55°C45-60°CBelow 37°C, Above 60°C
pH3.52.5-4.0Below 2.0, Above 4.5
Growth MediumAlicyclobacillus-specific mediumAcidified media with appropriate carbon sourcesNeutral or alkaline media

Alicyclobacillus acidocaldarius demonstrates robust growth at 55°C and pH 3.5, with growth rates (μ) reaching 0.57 h⁻¹ under these conditions. Cultures typically reach maximum optical density within 6-24 hours, with significant growth inhibition observed at pH values below 2.0 or above 4.5 .

How does the SecF protein from A. acidocaldarius compare functionally to SecF homologs from non-thermoacidophilic bacteria?

The SecF protein from Alicyclobacillus acidocaldarius presents several distinctive features compared to mesophilic homologs:

  • Increased hydrophobicity in transmembrane segments, associated with thermostability

  • Higher proportion of charged residues on surface-exposed regions

  • Modified active site architecture that maintains functionality under acidic conditions

  • Potentially altered interactions with SecD and SecY components

Experimental approaches for comparative functional analysis should include:

  • Complementation assays in heterologous systems

  • Site-directed mutagenesis targeting thermostability determinants

  • In vitro reconstitution with different Sec pathway components

  • Translocation assays at varying pH and temperature ranges

These differences likely reflect evolutionary adaptations enabling protein translocation to function efficiently in the extreme environment (pH 2.5-4.0, temperature 45-60°C) inhabited by Alicyclobacillus acidocaldarius .

What methodological considerations are important when assessing SecF function in protein translocation assays?

When designing translocation assays with recombinant SecF from Alicyclobacillus acidocaldarius:

  • Buffer System Selection:

    • Use buffers with sufficient buffering capacity at acidic pH (3.0-4.0)

    • Consider acetate, citrate, or succinate buffer systems

    • Ensure buffer stability at elevated temperatures (45-60°C)

  • Membrane Reconstitution Parameters:

    • Lipid composition should reflect the high proportion of cyclopropane fatty acids found in Alicyclobacillus membranes

    • Proteoliposome preparation requires careful pH control during reconstitution

    • Incorporate appropriate ratios of SecD, SecE, and SecY components

  • Substrate Selection:

    • Choose model substrates with stability at acidic pH

    • Consider native Alicyclobacillus secretory proteins as translocation substrates

    • Control for non-specific protein aggregation at experimental temperatures

  • Detection Methods:

    • Fluorescence-based assays may require pH correction factors

    • Protease protection assays should employ thermostable proteases

    • Western blotting detection may require modified protocols for acidic proteins

How does the genomic context of the secF gene inform understanding of Sec pathway evolution in thermoacidophiles?

The secF gene in Alicyclobacillus acidocaldarius is designated as Aaci_2101 in the genomic annotation. Analysis of its genomic context reveals:

  • The A. acidocaldarius genome contains 3,153 protein-coding genes with a high G+C content (61.9%), characteristic of thermophilic adaptations

  • The secF gene likely exists in an operon structure with other Sec pathway components, though the specific organization requires verification

  • Comparative genomic analysis between Alicyclobacillus strains shows:

    • Conservation of secF and other translocation components across thermoacidophiles

    • Potential horizontal gene transfer events in Sec pathway evolution

    • Co-evolution patterns with substrate proteins

  • Evolutionary analysis suggests adaptations in the SecF protein correlate with environmental parameters:

    • Amino acid substitutions favoring stability at low pH

    • Modified interaction surfaces for partner proteins

    • Residue conservation patterns distinct from mesophilic homologs

This genomic context provides crucial insights into how protein translocation systems adapt to extreme environments and may guide engineering efforts for heterologous protein expression in extreme conditions.

What expression systems are most effective for producing functional recombinant A. acidocaldarius SecF protein?

When designing expression systems for Alicyclobacillus acidocaldarius SecF:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, established protocolsPotential misfolding of membrane proteinsUse specialized strains (C41/C43), low induction temperature
Bacillus subtilisGram-positive background, better membrane integrationLower yieldsOptimize promoter strength, use controlled induction
Thermophilic expression hostsNative-like folding environmentLimited genetic toolsAdapt plasmid systems for thermostability
Cell-free systemsAvoids toxicity issuesExpensive, limited scaleSupplement with specific lipids and chaperones

For academic research applications, E. coli expression with the following modifications has proven most successful:

  • C-terminal fusion tags that minimize interference with membrane insertion

  • Induction at reduced temperatures (15-25°C) to allow proper membrane integration

  • Addition of specific membrane-stabilizing compounds (glycerol, specific lipids)

  • Careful detergent selection for extraction that maintains native conformation

The resulting recombinant protein requires validation for proper folding through functional assays and structural characterization before use in downstream applications.

What analytical techniques are most informative for studying SecF interactions with other Sec pathway components?

For comprehensive characterization of SecF interactions within the Sec translocase complex:

  • Crosslinking Approaches:

    • Photo-reactive amino acid incorporation at predicted interaction interfaces

    • Chemical crosslinking with bifunctional reagents stable at acidic pH

    • Mass spectrometric analysis of crosslinked products to identify interaction partners

  • Biophysical Interaction Analysis:

    • Surface Plasmon Resonance (SPR) with immobilized SecF in detergent micelles

    • Microscale Thermophoresis (MST) for measuring binding affinities under varying conditions

    • Isothermal Titration Calorimetry (ITC) adapted for membrane proteins

  • Structural Biology Approaches:

    • Cryo-electron microscopy of reconstituted Sec complexes

    • X-ray crystallography of stabilized subcomplexes

    • Nuclear Magnetic Resonance (NMR) of specifically labeled domains

  • Functional Reconstitution:

    • Proteoliposome-based translocation assays with defined component ratios

    • Single-molecule fluorescence to track translocation dynamics

    • Electrophysiological measurements of channel formation and activity

These methodologies should be adapted for the specific physiochemical properties of Alicyclobacillus acidocaldarius SecF, particularly accounting for optimal functionality at acidic pH and elevated temperatures.

How can researchers address the challenges of protein stability when working with A. acidocaldarius SecF?

The thermoacidophilic nature of Alicyclobacillus acidocaldarius SecF presents unique stability challenges that researchers should address through:

  • Buffer Formulation Strategy:

    • Include osmolytes such as glycerol (30-50%) to enhance stability

    • Add specific lipids that mimic the native membrane environment

    • Use reducing agents resistant to oxidation at elevated temperatures

    • Consider deuterated buffers for certain spectroscopic applications

  • Purification Protocol Modifications:

    • Maintain acidic conditions (pH 3.5-4.5) throughout purification

    • Incorporate heat steps (55°C) to eliminate contaminating proteins

    • Use detergents with demonstrated stability at extreme conditions

    • Minimize exposure to neutral pH conditions

  • Storage and Handling Considerations:

    • Store at -20°C or -80°C for long-term stability

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Maintain protein in Tris-based buffer with 50% glycerol

    • Keep working aliquots at 4°C for maximum of one week

  • Activity Preservation Techniques:

    • Perform functional assays at temperatures approximating physiological conditions (45-55°C)

    • Include stabilizing co-factors identified through biochemical analysis

    • Consider immobilization strategies for repeated use applications

    • Validate activity retention through time-course experiments

Implementation of these strategies can significantly improve experimental reproducibility and data quality when working with this challenging but informative extremophile protein.

What statistical approaches are most appropriate for analyzing SecF mutant phenotypes in complementation studies?

When evaluating the functional significance of SecF mutations through complementation assays:

These approaches ensure rigorous evaluation of SecF functional contributions while minimizing false positives due to statistical artifacts.

How can researchers distinguish between direct and indirect effects when studying SecF function in translocation assays?

To establish causality in SecF functional studies:

  • Control Experiment Framework:

    • Include catalytically inactive SecF mutants

    • Perform reconstitution with varying SecF concentrations

    • Include competition experiments with excess substrate or partner proteins

    • Design time-course experiments to establish order of events

  • Specific Controls for Thermoacidophilic Proteins:

    • Test activity across temperature and pH gradients

    • Compare activity with mesophilic homologs under permissive conditions

    • Verify membrane integrity at experimental conditions

    • Control for non-specific effects of temperature/pH on translocation substrates

  • Multi-Method Validation Approach:

    • Combine in vivo and in vitro assay systems

    • Correlate structural changes with functional outcomes

    • Employ different detection methodologies for the same phenomenon

    • Use orthogonal approaches to verify key findings

This systematic approach helps distinguish direct SecF-mediated effects from artifacts or indirect consequences of experimental manipulations.

How might understanding A. acidocaldarius SecF contribute to protein secretion system engineering?

The unique properties of Alicyclobacillus acidocaldarius SecF offer several biotechnological applications:

  • Thermostable Secretion Systems:

    • Engineering chimeric translocases incorporating thermostable SecF elements

    • Developing expression hosts with enhanced secretion at elevated temperatures

    • Creating systems for continuous processing at high temperatures

    • Designing secretion pathways functional in acidic industrial environments

  • Acidophilic Protein Production:

    • Utilizing SecF adaptations for efficient protein secretion at low pH

    • Developing expression systems for acid-stable enzymes

    • Creating platforms for proteins that require acidic environments for folding

    • Engineering reduced proteolysis systems leveraging acid conditions

  • Structure-Function Applications:

    • Identifying critical residues for extremophile adaptation

    • Transferring stability elements to mesophilic secretion systems

    • Developing predictive models for Sec system engineering

    • Creating designer secretion systems with novel specificities

These applications leverage the natural adaptations of A. acidocaldarius SecF to enhance protein secretion technologies for industrial and research applications.

What considerations are important when designing heterologous expression systems incorporating A. acidocaldarius SecF?

When engineering expression systems with Alicyclobacillus acidocaldarius SecF:

  • Host Compatibility Factors:

    • Codon optimization for expression host

    • Consideration of membrane composition differences

    • Assessment of chaperone compatibility

    • Evaluation of growth temperature limitations

  • System Design Elements:

    • Creation of chimeric systems with host-compatible components

    • Development of inducible expression controls suitable for the host

    • Engineering of SecF-SecD interactions appropriate for host membrane

    • Consideration of lipid requirements for proper function

  • Performance Evaluation Metrics:

    • Secretion efficiency compared to native systems

    • Thermostability of the engineered translocation complex

    • Substrate specificity changes

    • System robustness across varying conditions

  • Optimization Strategies:

    • Directed evolution for host compatibility

    • Rational design based on comparative genomics

    • Domain swapping with host Sec components

    • Machine learning approaches to predict optimal configurations

These considerations enable development of functional Sec-based secretion systems with enhanced properties derived from the thermoacidophilic adaptations of A. acidocaldarius SecF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.