Recombinant Aliivibrio salmonicida ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

ATP synthase subunit a (atpB) is a core component of the F0_0 sector of the ATP synthase complex, facilitating proton translocation across the membrane. In A. salmonicida, this subunit is encoded by the atpB gene (UniProt ID: B6EHU3) and consists of 270 amino acids . The recombinant form retains full-length functionality and is fused with an N-terminal His tag for purification .

Challenges:

  • Solubility issues in E. coli were mitigated using optimized codon usage and fusion tags (e.g., GST or MBP) .

  • DNA contamination in lysates was reduced via nuclease treatment .

3.2. Functional Assays

  • ATP hydrolysis assays: Measuring activity under varying pH and temperature conditions .

  • Antibody production: Polyclonal antibodies generated against atpB enable pathogen detection in aquaculture .

Comparative Analysis with Other Subunits

SubunitGeneLength (aa)FunctionRecombinant Form Available
aatpB270Proton channel formationYes
catpE85Rotational motor componentYes

Research Gaps and Future Directions

  • Thermodynamic profiling: No published data exist on atpB’s activity below 10°C, despite A. salmonicida’s cold-adapted ecology .

  • Pathogenicity linkage: The role of ATP synthase in virulence remains unexplored, though iron acquisition systems in A. salmonicida are temperature-regulated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format preferences. Please include your requirements in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on your purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal usage, store working aliquots at 4°C for a period of up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during the production process. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
atpB; VSAL_I3065; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
atpB
Target Protein Sequence
MAAPGEALTQSGYIEHHLSNLSLAKLGMVADETSFWNVHIDSLFFSVLTGMLFLWVFRSV AKKATTGVPGKLQCFVEMVVEFVADNVKETFHGRNPLVAPLALTIFCWVILMNLMDLIPI DFLPYSAAHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFAKELALHPF NHPIMIPFNLLLEVISLLAKPLSLGMRLFGNMFAGEVVFILIAAMLPWYLQWVGALPWAI FHILVILIQAFVFMMLTIVYLSMAHEDPDH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a in Aliivibrio salmonicida metabolism?

ATP synthase subunit a forms a critical part of the membrane-embedded F0 portion of the ATP synthase complex. This subunit contains transmembrane helices that create the pathway for proton translocation across the bacterial membrane, which drives ATP synthesis. In bacterial systems like A. salmonicida, ATP synthase functions as a rotary molecular machine where proton movement through subunit a causes rotation of the c-ring, which ultimately drives conformational changes in the F1 catalytic domain to synthesize ATP . The subunit a in A. salmonicida likely performs similar functions to other bacterial ATP synthases, forming part of the proton channel and interacting with subunit b to stabilize the complex architecture.

How does A. salmonicida ATP synthase structure compare with other bacterial homologs?

While specific structural data for A. salmonicida ATP synthase is limited, comparative analysis with other bacterial ATP synthases like that from Bacillus PS3 suggests that subunit a likely contains 5-6 transmembrane α-helices that interact with the rotating c-ring and the peripheral stator stalk . The architecture of the membrane region in bacterial ATP synthases is simpler than mitochondrial equivalents but performs the same core functions. The transmembrane proton pathway in bacterial ATP synthases typically involves conserved residues in subunit a, including a critical arginine residue that facilitates proton movement between the periplasmic and cytoplasmic sides of the membrane . Bacterial ATP synthases also feature distinctive subunit arrangements where loops in subunit a fill roles played by additional subunits in mitochondrial enzymes.

What sequence conservation exists between A. salmonicida atpB and other Vibrionaceae?

Sequence analysis would likely reveal high conservation of functional residues involved in proton translocation, particularly the arginine residue critical for proton movement and residues forming the proton channel. Comparative genomics indicates that ATP synthase genes are generally well-conserved across bacterial species, with variations primarily in non-catalytic regions. In Aliivibrio salmonicida, as with related Vibrionaceae, the ATP synthase operon organization is likely to follow the typical bacterial arrangement. While specific sequence data for A. salmonicida atpB isn't provided in the search results, researchers working with this organism would benefit from comparative analysis with other members of the Vibrionaceae family to identify conserved functional motifs.

What expression systems are most effective for producing functional A. salmonicida atpB?

For membrane proteins like ATP synthase subunit a, E. coli expression systems have proven effective, particularly when using specialized strains designed for membrane protein expression. Based on successful approaches with other bacterial ATP synthases, researchers should consider:

  • Using E. coli C41(DE3) or C43(DE3) strains that better tolerate membrane protein overexpression

  • Employing vectors with inducible promoters (like T7) with careful optimization of induction conditions

  • Expressing the protein with fusion tags that facilitate both purification and proper folding

  • Growing cultures at reduced temperatures (16-20°C) after induction to allow proper membrane insertion

The Bacillus PS3 ATP synthase was successfully expressed in E. coli and purified for structural studies, suggesting this approach may work for A. salmonicida ATP synthase components as well .

What purification protocol yields the highest purity and activity for recombinant atpB?

Based on successful purification strategies for bacterial ATP synthases, the following protocol is recommended:

Table 1: Recommended Purification Protocol for A. salmonicida atpB

StepProcedureCritical ParametersExpected Outcome
1. Cell LysisMechanical disruption or detergent treatmentBuffer with glycerol, protease inhibitorsMembrane fraction isolation
2. Membrane SolubilizationTreatment with glycol-diosgenin (GDN) at 1% (w/v)1 hour at room temperature with gentle mixingSolubilized membrane proteins
3. Affinity ChromatographyHisTrap column if His-tagged20 mM imidazole in wash bufferEnrichment of target protein
4. Size ExclusionSuperose 6 increase columnBuffer with 0.02% GDN, 150 mM NaClHigh-purity protein preparation
5. ConcentrationCentrifugal concentratorsAvoid excessive concentration~10 mg/ml final concentration

This protocol is modeled after the successful purification of Bacillus PS3 ATP synthase, which yielded protein suitable for high-resolution structural studies .

How can researchers verify the structural integrity of purified A. salmonicida atpB?

Verification of structural integrity requires multiple complementary approaches:

  • SDS-PAGE analysis to confirm molecular weight (~25-30 kDa expected for bacterial ATP synthase subunit a)

  • Western blotting with antibodies against conserved epitopes or affinity tags

  • Circular dichroism spectroscopy to assess secondary structure content, particularly alpha-helical content expected in membrane proteins

  • Limited proteolysis followed by mass spectrometry to evaluate proper folding

  • Reconstitution into liposomes or nanodiscs to assess functional activity

For ATP synthase components, verification of proper folding often requires assessing the ability to assemble with partner subunits, particularly subunit b, which forms critical interactions with specific transmembrane regions of subunit a .

What cryo-EM approaches are most suitable for resolving A. salmonicida ATP synthase structures?

Cryo-electron microscopy has revolutionized the structural biology of ATP synthases, as demonstrated by the 3.0-3.2 Å resolution structures obtained for Bacillus PS3 ATP synthase . For A. salmonicida ATP synthase:

  • Single-particle cryo-EM is the method of choice, with expected resolutions of 3.0-4.0 Å achievable

  • Sample preparation should focus on:

    • Optimizing detergent concentration to minimize background while maintaining protein stability

    • Grid optimization with different hole sizes and support films

    • Vitrification conditions to achieve optimal ice thickness

  • Data collection parameters should include:

    • Dose fractionation (40-50 frames per exposure)

    • Total electron dose limited to ~50 e-/Ų to minimize radiation damage

    • Collection of tilted data to address preferred orientation issues common with membrane proteins

  • Processing should employ multiple 3D classification steps to identify different rotational states of the complex

This approach successfully revealed three distinct rotational states of the Bacillus PS3 ATP synthase, including details of the membrane-embedded proton-conducting subunit a and associated subunit b .

How do mutations in conserved residues of atpB affect ATP synthase function?

Mutational analysis of conserved residues in ATP synthase subunit a provides critical insights into function:

Table 2: Functional Impact of Key Residue Mutations in ATP Synthase Subunit a

Residue TypeLocationFunctional Impact When MutatedDetection Method
ArginineTransmembrane interfaceLoss of proton translocationATP synthesis assay, proton pumping measurement
GlutamateProton channelAltered proton path, reduced efficiencypH-dependent fluorescence
GlycineHelix-helix interfaceDisrupted helix packing, assembly defectsBlue native PAGE, crosslinking
ProlineHelical kinksAltered transmembrane topologyProtease accessibility mapping

The critical arginine residue in subunit a is particularly important, as mutations at this position typically lead to complete loss of function. Structural studies of bacterial ATP synthases have shown that this arginine forms part of the proton pathway and interacts with the rotating c-ring .

What protein-protein interaction studies best elucidate atpB contacts within the ATP synthase complex?

To map the interactions of subunit a within the ATP synthase complex:

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linkers of varying lengths can identify proximity between subunits

    • Photo-activatable cross-linkers provide higher spatial resolution

    • Mass spectrometry analysis identifies specific interaction points

  • Co-purification assays:

    • Pull-down experiments with tagged subunit a to identify stable interaction partners

    • Stability of interactions under different detergent conditions indicates strength of association

  • FRET-based interaction mapping:

    • Site-specific fluorophore labeling of purified components

    • Measurement of energy transfer between labeled proteins indicates proximity and orientation

  • Hydrogen-deuterium exchange mass spectrometry:

    • Identifies regions protected from exchange due to protein-protein interactions

    • Provides dynamic information about interaction interfaces

Structural studies of bacterial ATP synthases have revealed that subunit a makes specific interactions with transmembrane helices of subunit b, with the two copies of subunit b forming different interactions with subunit a . These interactions are critical for proper assembly and function of the ATP synthase complex.

How can A. salmonicida ATP synthase components contribute to cold-water vibriosis vaccine development?

Aliivibrio salmonicida is the causative agent of cold-water vibriosis in farmed fish species, a disease now controlled by vaccination . ATP synthase components could potentially contribute to vaccine development through:

  • Immunogenicity assessment: While the search results indicate that peptidoglycan-associated lipoprotein (Pal) has been identified as a key immunogenic protein in A. salmonicida , other surface-exposed components like ATP synthase subunits might also contribute to vaccine efficacy. Researchers should investigate whether antibodies against ATP synthase components are generated during infection or vaccination.

  • Subunit vaccine development: If ATP synthase components prove immunogenic, they could be included in recombinant subunit vaccines. The successful cloning and expression of other A. salmonicida proteins (like Pal) provides a template for producing recombinant ATP synthase components for vaccine studies.

  • Cross-protection evaluation: Comparing ATP synthase sequence conservation across different Vibrionaceae strains could identify conserved epitopes that might provide cross-protection against multiple pathogens.

  • Adjuvant properties: Bacterial proteins can sometimes serve as both antigens and adjuvants; research should assess whether A. salmonicida ATP synthase components enhance immune responses to other vaccine components.

What insights can comparative studies of psychrophilic and mesophilic ATP synthases provide?

A. salmonicida thrives in cold marine environments, suggesting its ATP synthase may have adaptations for function at low temperatures:

  • Cold adaptation mechanisms:

    • Compare amino acid composition with mesophilic homologs to identify substitutions that enhance flexibility at low temperatures

    • Analyze regions involved in conformational changes during catalysis for cold-adaptive features

    • Examine lipid interactions that might facilitate membrane fluidity in cold conditions

  • Energy efficiency:

    • Measure ATP synthesis rates at different temperatures to assess thermal performance curves

    • Compare proton-to-ATP ratios with mesophilic counterparts

    • Investigate regulatory mechanisms that might optimize energy production in cold environments

  • Structural flexibility:

    • Analyze dynamics of loop regions and catalytic sites using molecular dynamics simulations

    • Compare thermal stability profiles between psychrophilic and mesophilic ATP synthases

    • Investigate ion pair and hydrogen bonding networks that might be modified for cold adaptation

Such comparative studies could reveal fundamental principles of protein cold adaptation and potentially inform biotechnological applications requiring enzyme function at low temperatures.

How can researchers overcome expression challenges with hydrophobic membrane proteins like atpB?

Membrane proteins present unique expression challenges that can be addressed through:

Table 3: Strategies for Improving Membrane Protein Expression

ChallengeStrategyImplementationExpected Outcome
ToxicityTight promoter controlUse of tightly regulated inducible systemsReduced leaky expression before induction
Inclusion body formationLowered expression temperatureShift to 16-20°C after inductionImproved membrane insertion
Poor membrane insertionFusion partnersN-terminal fusion with MBP or SUMOEnhanced folding and membrane targeting
Low yieldsSpecialized host strainsC41(DE3), C43(DE3), or Lemo21(DE3)Tolerance of membrane protein expression
AggregationCo-expression with chaperonesGroEL/GroES co-expressionImproved folding efficiency

Additionally, expression of just the critical domains of subunit a (rather than the full protein) might be considered if expression of the complete protein proves difficult.

What approaches effectively distinguish between properly folded and misfolded recombinant atpB?

Distinguishing properly folded membrane proteins requires multiple analytical approaches:

How can researchers optimize reconstitution of purified atpB into functional liposomes?

Functional reconstitution of ATP synthase components requires careful optimization:

  • Lipid composition:

    • Screen different lipid mixtures (POPC, POPE, cardiolipin)

    • Include native bacterial lipids if available

    • Optimize lipid-to-protein ratio (typically 50:1 to 200:1 w/w)

  • Reconstitution method:

    • Detergent removal using Bio-Beads or dialysis

    • Control rate of detergent removal to allow proper membrane insertion

    • Monitor liposome size distribution and homogeneity

  • Functional validation:

    • Establish artificial proton gradients using pH jumps or valinomycin/potassium gradients

    • Monitor proton translocation using pH-sensitive fluorescent dyes

    • Measure ATP synthesis activity when reconstituted with other ATP synthase components

  • Controls:

    • Parallel reconstitution of well-characterized membrane proteins

    • Preparation of protein-free liposomes to establish baseline leakage rates

    • Selective inhibition using known ATP synthase inhibitors

The protocols developed for reconstitution and functional analysis of other bacterial ATP synthases provide valuable templates for work with A. salmonicida components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.