Recombinant Aliivibrio salmonicida Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
rnfG; VSAL_I1868; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
rnfG
Target Protein Sequence
MLTIMKKSSLVLALFAIAATSLVMITYALTKDQIAYQQQQQLLSVLNQVVPKEQHDNELF KACTLVNNIDALGTNTPMPIYLASMNGKHTGAAIEAIAPDGYSGAIKIIVGVDSDSIVTG VRVLSHQETPGLGDKIDTRITRWVDGFLGKTVDSADDSSWAVQKDGGQFDQFTGATITPR AVVKAVKRAVWFYKTHQDELQTLPLNCEVK
Uniprot No.

Target Background

Function
A component of a membrane-bound complex responsible for coupling electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Aliivibrio salmonicida and why is it significant in microbial research?

Aliivibrio salmonicida (formerly classified as Vibrio salmonicida) is a fish pathogen responsible for cold water vibriosis in marine environments. This bacterium represents an important model organism for studying bacterial adaptation and pathogenesis in aquatic systems. Despite experiencing extensive gene decay with approximately half of its chitinolytic pathway genes disrupted by insertion sequences, recent research has demonstrated that A. salmonicida retains remarkable metabolic capabilities, including the ability to degrade and utilize chitin, the most abundant biopolymer in oceans . This unexpected functionality despite genomic deterioration makes A. salmonicida particularly interesting for studying bacterial evolution and environmental adaptation mechanisms.

What is the RnfG protein and what is its basic structure in Aliivibrio salmonicida?

The RnfG protein is a critical component of the electron transport complex (Rnf complex) in Aliivibrio salmonicida strain LFI1238. It is encoded by the rnfG gene (locus VSAL_I1868) and consists of 210 amino acids . The full sequence includes transmembrane regions and domains involved in electron transfer processes. The protein's structure features characteristic motifs common to electron transport proteins, including regions that facilitate interaction with other components of the Rnf complex. The recombinant protein is typically stored in Tris-based buffer with 50% glycerol for stability, as repeated freeze-thaw cycles can compromise its functional integrity .

What is the general function of the Rnf complex in bacterial metabolism?

The Rnf complex functions as an energy-coupled transhydrogenase in bacteria, primarily linking cellular pools of ferredoxin and NAD+ . Research in model organisms has revealed that this complex plays a dual role depending on the cellular energetic state:

  • When ferredoxin is more reduced than NADH: The complex catalyzes exergonic electron flow from ferredoxin to NAD+, generating a chemiosmotic potential across the membrane. This process is essential for energy conservation during autotrophic growth .

  • When NADH is more reduced than ferredoxin: The complex can work in reverse, using the membrane potential to drive the energetically unfavorable reduction of ferredoxin by NADH. This reaction is essential for growth on low-energy substrates to provide reduced ferredoxin, which is indispensable for biosynthesis and CO2 reduction .

This bidirectional electron transfer capability makes the Rnf complex a central component in the energy metabolism of many anaerobic bacteria.

What are the optimal methods for expressing and purifying recombinant Aliivibrio salmonicida RnfG protein?

Successful expression and purification of recombinant A. salmonicida RnfG requires careful consideration of several methodological factors:

Expression Systems:

  • E. coli-based expression systems (typically BL21(DE3) strains) with vectors containing His-tags for downstream purification

  • Induction parameters: 0.1-0.5 mM IPTG at lower temperatures (16-22°C) often improves yield for membrane-associated proteins

  • Expression time: 4-16 hours depending on temperature and strain viability

Purification Protocol:

  • Cell lysis in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane fraction isolation via ultracentrifugation

  • Membrane protein solubilization using appropriate detergents

  • IMAC purification using Ni-NTA resin for His-tagged protein

  • Size exclusion chromatography for further purification

Storage Considerations:
The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended periods . It's critical to avoid repeated freeze-thaw cycles as this significantly reduces protein activity and stability.

How can researchers effectively use Ni-NTA systems for purification of His-tagged RnfG protein?

Optimizing Ni-NTA purification for RnfG requires attention to several key factors:

Pre-purification Considerations:

  • Complete lysis and proper solubilization of membrane proteins is critical

  • Include low concentrations of imidazole (10-20 mM) in binding buffers to reduce non-specific binding

Purification Optimization:

  • Equilibrate Ni-NTA resin with binding buffer containing appropriate detergent

  • Apply clarified lysate at slow flow rates (0.5-1 ml/min)

  • Wash with incremental imidazole concentrations (20, 40, 60 mM)

  • Elute with 100-300 mM imidazole (either gradient or step elution)

Advanced Options:
Recent research demonstrates that Fe3O4/MPS@PAA/NTA-Ni2+ nanocomposites exhibit higher separation efficiency and binding capacity (93.4 mg/g) compared to conventional Ni-NTA resins . These magnetic beads offer excellent stability, tunable particle size, and surfaces amenable to further functionalization, making them particularly valuable for RnfG purification. Their selectivity and recyclability are maintained well for up to six purification cycles .

What analytical techniques are most suitable for assessing RnfG functionality in electron transport studies?

Multiple complementary techniques are required to comprehensively analyze RnfG functionality:

Spectroscopic Methods:

  • UV-visible spectroscopy to monitor redox changes

  • Electron paramagnetic resonance (EPR) to characterize paramagnetic species

  • Fluorescence spectroscopy for conformational analysis

Electrochemical Approaches:

  • Potentiometric titrations to determine redox potentials

  • Protein film voltammetry to study electron transfer kinetics

  • Membrane potential measurements using ion-specific probes

Functional Assays:

  • In vitro reconstitution of electron transport using purified components

  • NAD+/NADH ratio determination

  • Ferredoxin reduction/oxidation assays

  • Ion (Na+ or H+) translocation assays using membrane vesicles

Structural Analysis:

  • Cryo-electron microscopy or X-ray crystallography for structural characterization

  • Protein-protein interaction studies using pull-down assays or surface plasmon resonance

What evidence exists for ion translocation coupled to electron transport in the Rnf complex?

Several key lines of evidence support the role of the Rnf complex in ion translocation:

Direct Experimental Evidence:

  • Studies in Acetobacterium woodii have demonstrated that the Rnf complex catalyzes Na+ transport coupled to ferredoxin:NAD+ oxidoreductase activity

  • Ionophore experiments have confirmed that this Na+ transport is primary and electrogenic, creating an electrical potential across the membrane

  • Deletion of rnf genes in Methanosarcina acetivorans resulted in mutants unable to grow on acetate, with concurrent loss of both ferredoxin:heterodisulfide oxidoreductase activity and Na+ transport

Comparative Analyses:
Research across bacterial species indicates that Rnf complexes can be categorized into:

  • Na+-translocating variants (as in A. woodii)

  • H+-translocating variants (as in C. ljungdahlii)

This differentiation appears to reflect adaptation to specific environmental niches and energetic requirements . For marine bacteria like A. salmonicida, Na+-based systems would be advantageous given the high sodium content of their environment.

How does the Rnf complex in different bacterial species reflect adaptation to various ecological niches?

The Rnf complex demonstrates remarkable adaptability across bacterial species occupying different ecological niches:

Ion Specificity Adaptation:

  • Marine/halophilic bacteria: Tend toward Na+-translocating Rnf complexes that capitalize on naturally occurring Na+ gradients

  • Terrestrial/freshwater bacteria: Often utilize H+-translocating variants

  • This is illustrated by comparing A. woodii (Na+-dependent) with C. ljungdahlii (H+-dependent)

Metabolic Integration:

  • In acetogenic bacteria like A. woodii, the Rnf complex is tightly integrated with the Wood-Ljungdahl pathway

  • In C. ljungdahlii, despite being H+-dependent rather than Na+-dependent, the Rnf complex is essential for both autotrophic and heterotrophic growth

  • For pathogens like A. salmonicida, the complex likely interfaces with virulence-related metabolic pathways

Functional Categories:
Rather than categorizing acetogens as Na+- or H+-dependent organisms, recent research suggests classifying them into Ech- and Rnf-containing groups, with subgroups of Na+- and H+-dependent species . This classification better reflects the underlying bioenergetic mechanisms employed by these bacteria.

What are the current limitations in understanding RnfG structure-function relationships?

Despite significant advances, several critical aspects of RnfG structure-function relationships remain unresolved:

Structural Gaps:

  • High-resolution structures of RnfG and the complete Rnf complex are not yet available

  • The precise arrangement of electron transfer cofactors within the protein remains unknown

  • Structural determinants of ion specificity (H+ vs. Na+) are incompletely understood

Mechanistic Uncertainties:

  • The exact pathway of electrons through RnfG and the complete complex

  • How electron transfer is coupled to conformational changes in the protein

  • The rate-limiting steps in the electron transfer process

Environmental Adaptation:
How specific amino acid variations in A. salmonicida RnfG reflect adaptation to marine environments and cold-water conditions remains to be fully characterized.

Protein-Protein Interactions:
The specific interaction interfaces between RnfG and other Rnf subunits, as well as how these interactions change during the catalytic cycle, require further investigation.

What experimental approaches could resolve current limitations in understanding RnfG function?

Addressing knowledge gaps will require multidisciplinary approaches:

Structural Biology Techniques:

  • Cryo-electron microscopy of the intact Rnf complex

  • X-ray crystallography of individual components

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

Advanced Functional Analysis:

  • Single-molecule techniques to measure electron transfer in real-time

  • Reconstitution of the complex in nanodiscs or liposomes

  • Time-resolved spectroscopy to capture transient intermediates

Genetic Engineering:

  • CRISPR-Cas9 genome editing for precise manipulation of rnf genes

  • Site-directed mutagenesis guided by computational predictions

  • Construction of chimeric complexes to test structure-function hypotheses

Computational Methods:

  • Molecular dynamics simulations to model electron and ion transfer

  • Quantum mechanical calculations of electron transfer energetics

  • Systems biology modeling of the Rnf complex in cellular energy metabolism

How can insights from studying the Rnf complex contribute to our understanding of bacterial bioenergetics?

Research on the Rnf complex has broad implications for bacterial bioenergetics:

Diversified Energy Conservation Mechanisms:
The identification of the Rnf complex as a primary ion-translocating, membrane-bound electron transport system in diverse bacteria challenges previous assumptions about bacterial energy conservation strategies. Unlike conventional respiratory chains, the Rnf complex represents an alternative mechanism for generating ion gradients that can drive ATP synthesis .

Evolutionary Perspectives:
The widespread distribution of Rnf complexes across bacterial lineages suggests this may be an ancient and fundamental mechanism for energy coupling. Studying variations in the complex across species provides insights into the evolution of bioenergetic systems.

Metabolic Flexibility:
The bidirectional functionality of the Rnf complex (operating in forward or reverse depending on cellular energetic state) explains how some bacteria can grow on substrates that would otherwise not provide sufficient energy for biosynthesis and CO2 reduction . This metabolic flexibility is crucial for bacteria inhabiting fluctuating or energy-limited environments.

Environmental Adaptation:
The adaptation of the Rnf complex to different ion specificities (Na+ vs. H+) demonstrates how fundamental bioenergetic mechanisms can be modified to suit particular ecological niches, contributing to bacterial survival in diverse environments .

How can studying A. salmonicida RnfG contribute to understanding bacterial adaptation to marine environments?

A. salmonicida's RnfG provides a valuable model for understanding bacterial adaptation to marine environments:

Ion Gradient Utilization:
Marine bacteria must adapt to high external Na+ concentrations. Studying A. salmonicida's Rnf complex can reveal how pathogens leverage environmental Na+ gradients for bioenergetic advantage. This may involve specific structural adaptations in RnfG that enhance Na+ specificity or coupling efficiency.

Cold Adaptation Mechanisms:
As a cold-water pathogen, A. salmonicida's RnfG likely contains adaptations for maintaining electron transport efficiency at lower temperatures. Identifying these adaptations could provide insights into cold-temperature protein functioning.

Integration with Pathogenesis:
The relationship between energy metabolism (via the Rnf complex) and virulence in this fish pathogen may reveal how bioenergetic systems are integrated with pathogenesis mechanisms in marine bacterial pathogens.

Metabolic Flexibility:
A. salmonicida can degrade and utilize chitin despite gene decay in its chitinolytic pathway . This unexpected metabolic capability may be supported by energy conservation through the Rnf complex, highlighting how electron transport systems contribute to metabolic resilience.

What potential biotechnological applications might arise from understanding RnfG and the Rnf complex?

Understanding the Rnf complex opens several biotechnological avenues:

Bioenergy Applications:

  • Engineering efficient electron transfer systems in biofuel-producing organisms

  • Creating artificial electron bifurcation systems for improved energy conservation

  • Developing bio-electrochemical systems for electricity generation

Synthetic Biology:

  • Using the Rnf complex as a modular component for designing artificial electron transport chains

  • Creating chimeric complexes with enhanced electron transfer capabilities

  • Engineering redox balance mechanisms for optimized metabolic pathways

Protein Engineering:

  • Designing RnfG variants with enhanced stability or activity

  • Creating bio-inspired electron transfer devices based on Rnf architecture

  • Developing biosensors based on Rnf electron transfer properties

Bioprocess Optimization:

  • Manipulating Rnf activity to improve production of value-added compounds

  • Enhancing CO2 fixation efficiency in acetogenic bacteria

  • Improving bacterial growth on challenging substrates through optimized electron flow

What critical experiments should be prioritized to advance our understanding of A. salmonicida RnfG?

Several key experiments would significantly advance our understanding:

Structural Studies:
Priority should be given to determining the three-dimensional structure of A. salmonicida RnfG and the complete Rnf complex, using techniques such as cryo-electron microscopy or X-ray crystallography. This would provide critical insights into the arrangement of electron transfer components and ion channels.

Ion Specificity Determination:
Experiments to definitively establish whether the A. salmonicida Rnf complex translocates Na+ or H+ ions should be conducted using reconstituted systems and ion-specific probes. This would clarify its bioenergetic mechanism and environmental adaptation.

In Vivo Function:
Construction of rnfG deletion mutants in A. salmonicida, followed by phenotypic analysis under various growth conditions, would clarify the protein's role in vivo. Complementation studies with wild-type or mutated versions could identify critical functional regions.

Electron Transfer Kinetics:
Time-resolved spectroscopic studies to determine the rates of electron transfer through the complex would provide insights into its catalytic mechanism and efficiency.

Comparative Analysis: Systematic comparison of A. salmonicida RnfG with homologs from terrestrial bacteria could identify specific adaptations for functioning in marine environments, enhancing our understanding of bacterial adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.