Recombinant Aliivibrio salmonicida Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
frdC; VSAL_I2790; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
frdC
Target Protein Sequence
MSNRKPYVREMTRTWWKDHPFYRFYMVREATILPLIFFTICLLVGLGSLVKGPLAWASWL DFMANPIVVALNIVALAGSLFHAQTFFSMMPQVMPIRLGGKTLDKKVVVLAQWAAVAAIT LLVLVIV
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aliivibrio salmonicida and its significance in aquaculture research?

Aliivibrio salmonicida is the causative agent of cold-water vibriosis, a hemorrhagic septicemia that affects salmonid fish. This bacterium is notable for its ability to rapidly enter the fish bloodstream, followed by a latency period before proliferation occurs. Cold-water vibriosis represents a significant challenge in aquaculture, particularly in salmon farming operations. Understanding A. salmonicida's metabolism and virulence mechanisms provides critical insights for developing preventive measures and treatments . The bacterium's pathogenesis is characterized by the shedding of outer-membrane complexes, specifically VS-P1, which consists of lipopolysaccharide (LPS) and protein components that potentially act as decoys and contribute to immunomodulation of the host fish .

What is fumarate reductase subunit C (frdC) and its role in bacterial metabolism?

Fumarate reductase subunit C (frdC) is a critical component of the fumarate reductase (FRD) complex that plays an essential role in anaerobic respiration in Aliivibrio salmonicida. During anaerobic conditions, when oxygen is limited or absent, the bacterium utilizes fumarate as the terminal electron acceptor in the respiratory chain. The FRD complex catalyzes the reduction of fumarate to succinate, which is a reverse reaction of the TCA cycle enzyme succinate dehydrogenase. The frdC subunit specifically functions as a membrane anchor that, along with frdD, integrates the catalytic components of the complex (frdA and frdB) into the cytoplasmic membrane. Through its hydrophobic residues, particularly the sequence ILPLIFFTICLLVGLGSLVKG, frdC enables proper insertion into lipid bilayers and facilitates electron transfer from quinones to the catalytic subunits.

What structural features characterize recombinant A. salmonicida frdC protein?

The recombinant partial frdC protein, as referenced in UniProt (ID: B6EMS0), encompasses residues 1-127 of the native protein, which is fused to an N-terminal histidine (His) tag to facilitate purification. Key structural characteristics include:

Membrane-binding regions: Hydrophobic amino acid sequences that enable integration into lipid bilayers
Quinone interaction sites: Specific regions that interact with quinones to mediate electron transfer
His tag: N-terminal modification that allows for immobilized metal affinity chromatography (IMAC) purification

The following table compares structural and functional features of partial recombinant frdC versus the full-length protein:

FeaturePartial frdCFull-Length frdC
Amino acid range1-1271-217 (predicted)
Membrane associationRetainedEnhanced
Quinone bindingPartial activityFully functional

What are the optimal storage and handling conditions for recombinant frdC protein?

To maintain the structural integrity and functional activity of recombinant A. salmonicida frdC protein, researchers should adhere to the following storage and handling recommendations:

ParameterRecommendation
Freeze-thaw cyclesAvoid repeated cycles
Working aliquotsStore at 4°C ≤1 week
Long-term storageAdd 50% glycerol

Researchers should avoid repeated freeze-thaw cycles as these can lead to protein denaturation and loss of activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week, while long-term storage should include 50% glycerol as a cryoprotectant. Additionally, handling should minimize exposure to oxidizing agents and extreme pH conditions that could affect the membrane-binding properties of the protein.

How can heterologous expression systems be optimized for recombinant frdC production?

When expressing recombinant A. salmonicida frdC in heterologous systems like E. coli, researchers should consider several optimization strategies:

  • Codon optimization: Adapting the A. salmonicida codons to match E. coli codon usage preferences can enhance translation efficiency.

  • Induction conditions: Optimizing temperature, inducer concentration, and induction timing can significantly impact protein yield and solubility. Lower temperatures (15-25°C) often favor proper folding of membrane proteins.

  • Membrane integration: As frdC is a membrane protein, expression systems that facilitate proper membrane insertion should be selected. E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), may yield better results.

  • Purification strategy: The N-terminal His tag enables purification via IMAC, but detergent selection is crucial for maintaining protein stability during extraction from membranes. Mild detergents like n-dodecyl β-D-maltoside (DDM) are often suitable for membrane protein purification.

How can recombinant frdC be utilized to study A. salmonicida pathogenesis?

Recombinant A. salmonicida frdC serves as a valuable tool for investigating bacterial pathogenesis in cold-water vibriosis. Researchers can employ this protein in several experimental approaches:

  • Metabolic adaptation studies: Investigating how A. salmonicida adapts its respiratory metabolism during different stages of infection using recombinant frdC in enzymatic assays.

  • Host-pathogen interaction analysis: Examining potential interactions between frdC-containing bacterial membrane structures and host immune components.

  • Comparative virulence studies: Creating frdC knockout or modified strains to assess the role of anaerobic respiration in virulence, similar to methodologies used to study O-antigen's role in A. salmonicida virulence .

  • Vaccine development research: Evaluating the potential of frdC as a component in subunit vaccines, considering its role in bacterial metabolism during infection. This approach complements existing vaccines against cold-water vibriosis, such as the Aeromonas salmonicida-Vibrio anguillarum-ordalii-salmonicida Bacterin .

What enzyme kinetic parameters can be measured using recombinant frdC in the FRD complex?

Recombinant frdC, as part of the reconstituted FRD complex, enables researchers to determine various enzyme kinetic parameters. These measurements provide insights into the catalytic efficiency and substrate specificity of the complex:

  • Substrate specificity: Evaluating the complex's activity with alternate substrates such as 2-methylfumarate compared to fumarate.

  • Kinetic constants: Determining Km and Vmax values for fumarate reduction under various conditions.

  • Inhibition studies: Measuring inhibition constants (Ki) for various compounds to identify potential inhibitors that could serve as antimicrobial targets.

  • Electron donor preferences: Analyzing the efficiency of different quinones as electron donors for the FRD complex.

The kinetic analysis typically requires the complete FRD complex, with frdC and frdD providing the membrane anchor for the catalytic frdA and frdB subunits.

How does the quinone-binding site in frdC contribute to electron transfer in the FRD complex?

The quinone-binding site in frdC plays a critical role in electron transfer within the FRD complex. Research approaches to study this function include:

  • Site-directed mutagenesis: Altering specific residues in the quinone-binding region to identify essential amino acids for quinone interaction.

  • Electron paramagnetic resonance (EPR) spectroscopy: Monitoring electron transfer between quinones and the FRD complex to elucidate the mechanism and kinetics of this process.

  • Structural comparisons: Analyzing structural similarities and differences between A. salmonicida frdC and homologous proteins from other bacteria, such as E. coli, where the crystal structure of the entire FRD complex has been solved.

The partial recombinant frdC (residues 1-127) retains some quinone-binding activity, although full functionality requires the complete protein (predicted to span residues 1-217). This makes the recombinant protein valuable for preliminary studies, while acknowledging its limitations for comprehensive functional characterization.

What crystallization approaches are most effective for structural studies of membrane proteins like frdC?

Membrane proteins such as frdC present significant challenges for structural biology due to their hydrophobic nature and requirement for a lipid environment. Effective crystallization approaches include:

  • Detergent screening: Systematic testing of different detergents and detergent mixtures to identify those that maintain protein stability and facilitate crystal formation.

  • Lipidic cubic phase (LCP) crystallization: This method provides a membrane-mimetic environment that can improve crystallization success for membrane proteins.

  • Protein engineering: Creating fusion proteins or truncated constructs to enhance solubility and crystallization propensity. The partial recombinant frdC (residues 1-127) represents such an approach.

  • Co-crystallization with antibody fragments: Using Fab or Fv fragments to increase the hydrophilic surface area available for crystal contacts.

  • Cryo-electron microscopy (cryo-EM): As an alternative to crystallography, cryo-EM has become increasingly valuable for determining membrane protein structures, particularly for larger complexes like the complete FRD.

How does A. salmonicida frdC compare to homologous proteins in other bacterial pathogens?

Comparative analysis of A. salmonicida frdC with homologous proteins from other bacterial species provides valuable evolutionary and functional insights:

  • Sequence conservation: Multiple sequence alignment reveals conserved regions that likely represent functionally important domains, particularly membrane-spanning segments and quinone-binding sites.

  • Pathogen-specific adaptations: Identifying unique features in A. salmonicida frdC that might represent adaptations to its specific ecological niche as a cold-water fish pathogen.

  • Structural homology modeling: Using solved structures of homologous proteins (e.g., from E. coli) to predict structural features of A. salmonicida frdC through computational modeling.

This comparative approach can inform experimental design by highlighting regions of interest for mutagenesis or inhibitor design targeting pathogen-specific features.

What is the relationship between frdC function and cold adaptation in A. salmonicida?

As a cold-water pathogen, A. salmonicida has evolved mechanisms to maintain metabolic efficiency at lower temperatures. The role of frdC in this adaptation can be investigated through several approaches:

  • Temperature-dependent enzyme kinetics: Comparing the activity of the FRD complex containing A. salmonicida frdC at different temperatures (4°C to 37°C) to assess cold adaptation of respiratory functions.

  • Membrane fluidity interactions: Examining how frdC integration into membranes is affected by temperature, potentially revealing adaptations that maintain functionality in cold environments where membrane fluidity is reduced.

  • Comparative genomics: Analyzing differences in frdC sequence and regulation between cold-water pathogens and related mesophilic species to identify putative cold-adaptation features.

Understanding these adaptations is particularly relevant for aquaculture applications, where managing cold-water vibriosis requires knowledge of how A. salmonicida remains metabolically active and virulent in cold environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.