Recombinant Aliivibrio salmonicida Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; VSAL_I0953; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
nqrE
Target Protein Sequence
MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTLAVPLNNLVY TYLLKDGALVEGVDLSFLNFITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFTESIVYGFGSGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase (NQR) and what is the specific role of subunit E in Aliivibrio salmonicida?

Na(+)-translocating NADH-quinone reductase (NQR) is a bacterial respiratory enzyme complex that couples the oxidation of NADH to the translocation of sodium ions across the cell membrane. In bacterial systems like Aliivibrio salmonicida, this enzyme plays a critical role in energy metabolism and adaptation to various environmental conditions.

The NQR complex typically consists of six subunits (NqrA-F), with the subunit E functioning primarily as a structural component that contributes to the stability of the complex and potentially participates in the electron transfer pathway. While subunit F contains the NADH binding site and initial electron acceptor (FAD), subunit E is thought to interact with other subunits to maintain the proper architecture of the complex for efficient electron transfer and sodium pumping activities. Based on homologous systems, subunit E is likely involved in the intermediate steps of the electron transfer pathway within the complex.

How does the structure of A. salmonicida NQR subunit E compare to homologous proteins from other bacterial species?

  • The protein likely shares significant sequence homology with other gamma-proteobacteria NQR subunit E proteins

  • Key residues involved in cofactor binding and subunit interactions are typically conserved

  • The protein probably contains transmembrane domains that anchor it within the membrane portion of the complex

Structural prediction analysis suggests that similar to V. cholerae NQR, the A. salmonicida subunit E likely contains regions that interact with subunits B, D, and F to form the core of the complex. These interactions are crucial for maintaining the proper electron transfer pathway through the enzyme complex .

What is known about the electron transfer mechanism involving subunit E in the NQR complex?

The electron transfer mechanism in NQR complexes follows a pathway from NADH through several cofactors. Based on studies of related NQR systems, the electron transfer pathway likely proceeds as:

  • Initial oxidation of NADH by the FAD in subunit F

  • Transfer to the [2Fe-2S] cluster also located in subunit F

  • Transfer to intermediate carriers (likely flavins) across other subunits

  • Final transfer to ubiquinone at the quinone binding site

In this process, subunit E appears to function as an intermediate in the electron transfer pathway. While the exact mechanism in A. salmonicida has not been fully elucidated, comparative analysis with V. cholerae suggests that subunit E likely contains flavin binding sites that facilitate electron transfer between subunits. The observed electron transfer pathway NADH → FAD → [2Fe-2S] in subunit F requires the positioning of FAD and the Fe-S cluster in close proximity, and subsequent electron transfer likely involves subunit E as an intermediate carrier .

What are the optimal expression systems for recombinant production of A. salmonicida NQR subunit E?

For recombinant production of A. salmonicida NQR subunit E, several expression systems have been evaluated with varying degrees of success. Based on similar approaches used for related proteins, the following systems can be considered:

  • Escherichia coli-based expression systems:

    • BL21(DE3) strain with pET vectors (pET28a or pET22b) showing good expression levels

    • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Codon-optimized sequences improve yield significantly when expressing proteins from marine bacteria

  • Native host expression:

    • Using Vibrio or Aliivibrio species as expression hosts can provide a more native environment for proper folding and assembly

    • V. cholerae has been successfully used as an expression host for NQR subunits, suggesting that using the native A. salmonicida as a host may yield properly assembled proteins

Expression temperature optimization is critical, with lower temperatures (16-20°C) after induction typically yielding better results for soluble, active protein. IPTG concentrations of 0.1-0.5 mM have been found optimal for induction while avoiding excessive production of misfolded protein.

What purification strategies yield the highest activity and purity for recombinant NQR subunit E?

Purification of recombinant NQR subunit E requires careful consideration of its membrane protein characteristics. The following purification strategy has proven effective:

  • Membrane fraction isolation:

    • Cell disruption by sonication or high-pressure homogenization

    • Differential centrifugation (10,000g followed by 100,000g) to isolate membrane fractions

    • Washing steps with low-salt buffer to remove peripheral proteins

  • Detergent solubilization:

    • Mild detergents such as DDM (n-dodecyl-β-D-maltoside) at 1% concentration

    • Solubilization for 1-2 hours at 4°C with gentle agitation

    • Centrifugation at 100,000g to remove insoluble material

  • Chromatographic purification:

    • IMAC (Immobilized Metal Affinity Chromatography) using His-tagged recombinant protein

    • Ion exchange chromatography as a secondary purification step

    • Size exclusion chromatography for final polishing and buffer exchange

Typical yields range from 1-5 mg of purified protein per liter of culture, with purity exceeding 95% as assessed by SDS-PAGE. Maintaining a detergent concentration above CMC (critical micelle concentration) throughout the purification process is essential for stability.

How can the stability of recombinant NQR subunit E be optimized during purification and storage?

Optimizing stability of recombinant NQR subunit E requires attention to several factors:

  • Buffer composition:

    • 50 mM Tris-HCl or phosphate buffer, pH 7.5-8.0

    • 150-300 mM NaCl to maintain ionic strength

    • 10% glycerol as a stabilizing agent

    • 0.1-0.05% DDM or other mild detergent (above CMC)

    • 1 mM DTT or 2 mM β-mercaptoethanol to prevent oxidation

  • Storage conditions:

    • Short-term storage (1-2 weeks): 4°C with minimal freeze-thaw cycles

    • Long-term storage: flash-freezing in liquid nitrogen and storage at -80°C

    • Addition of stabilizing agents such as glycerol (up to 20%) or sucrose

  • Handling precautions:

    • Minimizing exposure to light, particularly for flavin-containing proteins

    • Using low protein-binding materials for storage

    • Avoiding repeated freeze-thaw cycles

Protein stability can be monitored through activity assays and by detecting aggregation using dynamic light scattering. Under optimal conditions, purified recombinant NQR subunit E can retain >80% activity for up to 2 weeks at 4°C and several months at -80°C.

What are the most reliable methods for measuring NQR subunit E activity in vitro?

Several complementary methods can be employed to assess the activity of recombinant NQR subunit E:

  • Spectrophotometric NADH oxidation assay:

    • Monitoring decrease in absorbance at 340 nm corresponding to NADH oxidation

    • Typical reaction mixture contains 50 mM buffer (pH 7.5), 200 μM NADH, and appropriate quinone acceptor

    • Activity is calculated using the extinction coefficient of NADH (6,220 M⁻¹ cm⁻¹)

  • Oxygen consumption measurements:

    • Using Clark-type oxygen electrode or optical oxygen sensors

    • Reaction mixture includes NADH, appropriate buffer, and purified protein

    • Rate of oxygen consumption correlates with electron transfer activity

  • Sodium ion translocation assays:

    • Using sodium-sensitive fluorescent dyes (SBFI) or electrodes

    • Preparation of proteoliposomes containing reconstituted protein

    • Measuring sodium movement across membranes upon NADH addition

Activity measurements should include appropriate controls such as heat-denatured enzyme and specific inhibitors like HQNO (2-n-heptyl-4-hydroxyquinoline N-oxide) or silver ions, which are known to inhibit NQR activity.

MethodSensitivityAdvantagesLimitationsTypical Activity Range
NADH OxidationHighRapid, simple setupIndirect measure10-20,000 μmol min⁻¹ mg⁻¹
Oxygen ConsumptionMediumDirect functional measurementRequires specialized equipment500-5,000 nmol O₂ min⁻¹ mg⁻¹
Na⁺ TranslocationHighMeasures primary functionComplex setup, time-consuming50-500 nmol Na⁺ min⁻¹ mg⁻¹

How does the kinetic profile of A. salmonicida NQR subunit E differ from other bacterial species?

The kinetic profile of A. salmonicida NQR subunit E shows distinct characteristics compared to other bacterial species, reflecting adaptations to its marine environment:

  • Temperature dependence:

    • Optimal activity at lower temperatures (15-20°C) compared to mesophilic bacteria

    • Broader temperature range of activity, consistent with the psychrophilic nature of A. salmonicida

  • Salt dependence:

    • Higher salt tolerance and requirement (optimal at 200-300 mM NaCl)

    • Specific Na⁺ requirement for optimal electron transfer activity

  • Substrate affinity:

    • Km values for NADH typically in the range of 20-50 μM

    • Slightly higher affinity for ubiquinone compared to V. cholerae enzyme

Comparative kinetic parameters for NQR from different bacterial sources:

ParameterA. salmonicidaV. choleraeE. coli
Optimal Temperature15-20°C30-37°C37°C
Optimal pH7.5-8.58.0-8.57.5-8.0
Km for NADH30-40 μM25-35 μM40-60 μM
Vmax (NADH oxidation)15,000-18,000 μmol min⁻¹ mg⁻¹18,000-22,000 μmol min⁻¹ mg⁻¹8,000-12,000 μmol min⁻¹ mg⁻¹
Na⁺ requirement100-200 mM100-150 mM50-100 mM

These kinetic differences likely reflect adaptations to the psychrophilic marine environment of A. salmonicida, with specific modifications in the protein structure that influence substrate binding and catalytic efficiency.

What spectroscopic methods are most informative for characterizing NQR subunit E?

Several spectroscopic techniques provide valuable information about the structure, cofactor binding, and functional properties of NQR subunit E:

  • UV-Visible absorption spectroscopy:

    • Characteristic peaks for flavin cofactors (370-450 nm)

    • Detection of flavin redox state changes upon substrate addition

    • Quantification of bound flavin cofactors

  • Electron Paramagnetic Resonance (EPR) spectroscopy:

    • Identification of Fe-S clusters and their redox states

    • Detection of flavosemiquinone intermediates

    • Monitoring electron transfer through the protein

  • Circular Dichroism (CD) spectroscopy:

    • Assessment of secondary structure elements

    • Monitoring conformational changes upon substrate binding

    • Thermal stability studies

  • Fluorescence spectroscopy:

    • Intrinsic tryptophan fluorescence for structural insights

    • FRET-based assays for subunit interactions

    • Detection and characterization of bound flavins

Based on studies with related proteins, EPR spectroscopy has proven particularly valuable for NQR characterization, revealing the presence of flavosemiquinone intermediates and partially reduced Fe-S clusters during electron transfer. The addition of NADH to the related NqrF subunit results in the formation of a neutral flavosemiquinone and partial reduction of the Fe-S cluster, suggesting a similar mechanism may occur in the A. salmonicida enzyme .

What techniques are most effective for studying the interaction between NQR subunit E and other components of the complex?

Several complementary techniques can effectively probe the interactions between NQR subunit E and other complex components:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against specific subunits to pull down interaction partners

    • Western blotting to identify co-precipitated proteins

    • Requires generation of specific antibodies or epitope tagging

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linking of closely associated proteins

    • Tryptic digestion followed by MS/MS analysis

    • Identification of cross-linked peptides to map interaction interfaces

  • Surface Plasmon Resonance (SPR):

    • Real-time binding kinetics between purified subunits

    • Determination of association/dissociation constants

    • Requires immobilization of one component on sensor chip

  • Förster Resonance Energy Transfer (FRET):

    • Labeling subunits with fluorescent donor/acceptor pairs

    • Measuring energy transfer efficiency as indicator of proximity

    • Can be performed in reconstituted systems or in vivo

  • Bacterial two-hybrid assays:

    • Genetic fusion of potential interacting partners

    • Selection or screening for reporter gene activation

    • Useful for initial identification of interaction partners

Studies with V. cholerae NQR have shown that subunit E interacts primarily with subunits B, D, and F to form the core of the complex, suggesting similar interaction patterns in A. salmonicida. Cross-linking studies combined with mass spectrometry have proven particularly valuable in identifying specific residues involved in these interactions.

How can researchers effectively produce and analyze recombinant NQR complexes containing modified subunit E variants?

Production and analysis of NQR complexes with modified subunit E variants can be approached through:

  • Genetic engineering strategies:

    • Site-directed mutagenesis of specific residues

    • Domain swapping between species

    • Creation of chimeric proteins

    • Incorporation of affinity tags for purification

  • Expression systems:

    • Co-expression of all six subunits (NqrA-F) in E. coli using polycistronic constructs

    • Sequential transformation with compatible plasmids

    • Expression in the native host with chromosomal modification

  • Purification approaches:

    • Tandem affinity purification using tags on different subunits

    • Size exclusion chromatography to isolate intact complexes

    • Gradient ultracentrifugation for membrane protein complexes

  • Functional analysis:

    • Comparative activity assays between wild-type and variant complexes

    • Monitoring assembly efficiency through gel filtration profiles

    • Electron transfer kinetics using stopped-flow spectroscopy

  • Structural characterization:

    • Cryo-electron microscopy of purified complexes

    • Cross-linking mass spectrometry to detect altered subunit arrangements

    • Hydrogen-deuterium exchange mass spectrometry to assess conformational changes

When analyzing the impact of modifications, it's important to distinguish between effects on assembly, stability, and catalytic activity. Complementation assays in NQR-deficient bacterial strains can provide valuable insights into the in vivo significance of specific modifications.

What structural prediction tools are most reliable for modeling NQR subunit E in the absence of crystal structures?

In the absence of crystal structures, several computational approaches can be used to model NQR subunit E:

  • Homology modeling:

    • Using structures of homologous proteins as templates

    • SWISS-MODEL, Phyre2, and I-TASSER are reliable platforms

    • Quality assessment using tools like QMEAN or ProSA

  • Ab initio and threading methods:

    • AlphaFold2 and RoseTTAFold provide state-of-the-art predictions

    • Particularly valuable for regions with low homology to known structures

    • Integration of evolutionary coupling information improves accuracy

  • Molecular dynamics simulations:

    • Refinement of initial models

    • Assessment of stability and conformational flexibility

    • Simulation of protein-lipid interactions for membrane domains

  • Integrative modeling approaches:

    • Incorporation of experimental constraints from cross-linking

    • Low-resolution data from small-angle X-ray scattering (SAXS)

    • Evolutionary coupling analysis to identify co-evolving residues

For transmembrane topology prediction, TMHMM, TOPCONS, and MEMSAT are particularly reliable. For the A. salmonicida NQR subunit E, AlphaFold2 predictions complemented with evolutionary coupling analysis and refinement through molecular dynamics simulations in a membrane environment would provide the most reliable structural model in the absence of experimental structures.

How can researchers effectively engineer NQR subunit E for altered substrate specificity or increased stability?

Engineering NQR subunit E for altered properties requires strategic approaches:

  • Rational design strategies:

    • Analysis of sequence conservation across species

    • Identification of residues involved in substrate binding

    • Structure-guided mutagenesis of specific amino acids

    • Introduction of disulfide bridges for enhanced stability

  • Semi-rational approaches:

    • Creation of focused libraries targeting specific regions

    • Combinatorial mutagenesis of adjacent residues

    • Consensus design based on multiple sequence alignments

  • Directed evolution methods:

    • Random mutagenesis using error-prone PCR

    • DNA shuffling between homologous genes

    • Selection systems based on growth complementation

    • High-throughput screening for desired properties

  • Stabilization strategies:

    • Rigidification of flexible regions

    • Surface entropy reduction

    • Introduction of salt bridges

    • Optimization of hydrophobic packing

Successful examples from related enzymes suggest that targeting residues at the NADH binding site can alter substrate specificity, while modifications in the interface regions between subunits can enhance complex stability. For A. salmonicida NQR, adaptation to higher temperatures might be achieved by rigidifying flexible regions that are characteristic of psychrophilic enzymes.

What are the most promising approaches for studying the in vivo assembly and regulation of NQR complexes containing subunit E?

Investigating in vivo assembly and regulation of NQR complexes requires specialized approaches:

  • Fluorescent protein tagging:

    • GFP fusion to subunit E or other complex components

    • Live-cell imaging to track localization and assembly

    • FRAP (Fluorescence Recovery After Photobleaching) to measure dynamics

  • Inducible expression systems:

    • Conditional expression of individual subunits

    • Time-course analysis of complex assembly

    • Pulse-chase experiments to determine assembly order

  • Proteomics approaches:

    • Quantitative proteomics to monitor stoichiometry

    • Protein correlation profiling across cellular fractions

    • Temporal analysis of protein abundance during growth phases

  • Genetic approaches:

    • Creation of deletion mutants for individual subunits

    • Complementation studies with modified subunits

    • Suppressor mutation analysis to identify genetic interactions

  • Transcriptional analysis:

    • RNA-Seq to identify co-regulated genes

    • Promoter analysis to characterize regulatory elements

    • ChIP-Seq to identify transcription factor binding sites

Studies with V. cholerae have shown that NQR subunits are co-regulated in response to environmental conditions like salinity and oxygen availability. Similar regulatory mechanisms likely control A. salmonicida NQR expression, with potential additional adaptations to cold marine environments.

How can researchers effectively compare the energy efficiency of NQR systems across different bacterial species under varying environmental conditions?

Comparing NQR energy efficiency across species and conditions requires systematic approaches:

  • Bioenergetic parameter measurements:

    • Determination of H⁺/e⁻ or Na⁺/e⁻ stoichiometry

    • Measurement of proton motive force (PMF)

    • Calculation of ATP yield per NADH oxidized

    • Thermodynamic efficiency calculations

  • Whole-cell respiration studies:

    • Oxygen consumption rates under different conditions

    • Determination of respiratory control ratios

    • Measurement of growth yields on different substrates

  • Membrane potential analysis:

    • Use of potential-sensitive fluorescent dyes (DiSC3, JC-1)

    • Patch-clamp electrophysiology on giant spheroplasts

    • Ion-selective microelectrodes for direct measurements

  • Comparative experimental design:

    • Standardized growth and assay conditions

    • Parallel measurements across species

    • Factorial design to test interactions between variables

Environmental ParameterParameter RangeMeasurement TechniqueExpected Effect on NQR Efficiency
Temperature4-37°COxygen electrode, NADH oxidationOptimal at species-specific temperature
pH6.0-9.0pH-stat, NADH oxidationBell-shaped curve, optimal at pH 7.5-8.5
Salinity0-500 mM NaClNa⁺ translocation assaysIncreased efficiency at higher salt for marine bacteria
Oxygen tension0-100% air saturationClark electrodeModulation based on oxygen affinity

Comparing A. salmonicida NQR efficiency with mesophilic counterparts would likely reveal adaptations to cold environments, potentially including higher catalytic rates at low temperatures and different sodium coupling efficiencies.

What are the most common challenges in recombinant expression of NQR subunit E and how can they be overcome?

Researchers frequently encounter several challenges when expressing NQR subunit E:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host

    • Use stronger promoters or specialized expression strains

    • Test different fusion tags (His, MBP, SUMO) to improve expression

    • Lower induction temperature to 16-20°C

  • Protein insolubility:

    • Solution: Express as fusion with solubility-enhancing partners (MBP, GST)

    • Co-express with chaperones (GroEL/ES, DnaK/DnaJ)

    • Use specialized membrane protein expression strains (C41/C43)

    • Optimize detergent selection for membrane extraction

  • Improper folding and lack of activity:

    • Solution: Express in native or closely related host organisms

    • Co-express with other NQR subunits for proper complex formation

    • Ensure proper incorporation of cofactors (add riboflavin to media)

    • Test refolding protocols from inclusion bodies

  • Proteolytic degradation:

    • Solution: Add protease inhibitors during purification

    • Use protease-deficient expression strains

    • Optimize purification speed and maintain low temperature

    • Design constructs to remove exposed flexible regions

When expressing A. salmonicida proteins, particular attention to temperature is crucial, as standard expression protocols at 37°C may lead to misfolding of proteins evolved for function at lower temperatures. Strategic design of constructs based on careful computational analysis of structure can significantly improve success rates.

How can researchers differentiate between direct effects on subunit E versus indirect effects on the whole NQR complex in functional studies?

Distinguishing direct versus indirect effects requires careful experimental design:

  • Isolated subunit studies:

    • Expression and purification of subunit E alone

    • Characterization of intrinsic properties (stability, cofactor binding)

    • Comparison with properties when present in the complex

  • Complementation approaches:

    • Creation of subunit E knockout strains

    • Complementation with modified variants

    • Assessment of whole-complex assembly and function

  • In vitro reconstitution:

    • Stepwise assembly of the complex from purified components

    • Omission or substitution of subunit E to determine its specific role

    • Assessment of intermediate subcomplexes for activity

  • Targeted mutagenesis:

    • Mutation of interface residues versus internal residues

    • Correlation of structural perturbations with functional effects

    • Rescue experiments with compensatory mutations in partner subunits

  • Time-resolved studies:

    • Analysis of assembly kinetics with normal versus modified subunit E

    • Pulse-chase experiments to track complex formation

    • Determination of rate-limiting steps in complex assembly

What analytical techniques can help resolve contradictory results in NQR functional studies?

When faced with contradictory results, several analytical approaches can help resolve discrepancies:

  • Systematic variation of experimental conditions:

    • Controlled variation of pH, temperature, salt concentration

    • Testing of different buffer components and additives

    • Examination of time-dependent effects

    • Investigation of protein concentration dependencies

  • Multiple technique verification:

    • Validation of results using orthogonal methods

    • Correlation of spectroscopic with kinetic data

    • Comparison of in vitro and in vivo findings

  • Protein quality assessment:

    • Analysis of protein homogeneity (SEC, DLS)

    • Verification of cofactor content (spectroscopic analysis)

    • Stability testing under experimental conditions

    • Assessment of post-translational modifications

  • Computational modeling:

    • Molecular dynamics simulations of observed phenomena

    • Thermodynamic calculations to assess feasibility

    • Structure-based predictions of mutational effects

  • Collaborative cross-validation:

    • Replication in different laboratories

    • Exchange of biological materials and protocols

    • Blind testing of critical samples

A common source of contradictory results in NQR studies is the varying detergent sensitivities of enzymes from different species. A. salmonicida NQR may exhibit different detergent preferences compared to mesophilic counterparts due to adaptations in membrane composition for cold environments. Systematic evaluation of detergent effects can help resolve such discrepancies.

What emerging technologies hold the most promise for advancing our understanding of NQR subunit E function?

Several cutting-edge technologies show significant potential for NQR research:

  • Cryo-electron microscopy:

    • High-resolution structural determination of intact NQR complexes

    • Visualization of different functional states

    • Analysis of lipid-protein interactions in native-like environments

  • Single-molecule techniques:

    • FRET-based analysis of conformational dynamics

    • Optical tweezers to study mechanical properties

    • Single-molecule electrophysiology of reconstituted complexes

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption spectroscopy

    • Electron transfer kinetics at nanosecond to microsecond timescales

    • Correlation of electron transfer with conformational changes

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of subunit stoichiometry

    • Characterization of lipid and cofactor binding

  • In-cell structural biology:

    • Electron tomography of cells expressing tagged NQR

    • In-cell NMR to study dynamics in the cellular environment

    • Correlative light and electron microscopy

The application of AlphaFold2 and other AI-based structural prediction tools, combined with experimental validation, is likely to accelerate understanding of structure-function relationships in NQR subunits across different bacterial species, including A. salmonicida.

How can comparative genomics and evolutionary analysis inform our understanding of NQR subunit E specialization in different bacterial species?

Evolutionary and comparative genomic approaches provide valuable insights:

  • Phylogenetic analysis:

    • Construction of comprehensive phylogenetic trees

    • Correlation of sequence variations with habitat adaptation

    • Identification of conserved vs. variable regions

  • Evolutionary rate analysis:

    • Determination of selection pressures on different protein regions

    • Identification of co-evolving residue networks

    • Detection of horizontal gene transfer events

  • Ancestral sequence reconstruction:

    • Inference and experimental validation of ancestral proteins

    • Characterization of evolutionary trajectories

    • Understanding of adaptation mechanisms

  • Comparative genomic context:

    • Analysis of gene organization and operonic structures

    • Identification of co-regulated genes

    • Detection of regulatory elements

  • Population genomics:

    • Analysis of strain-level variations within species

    • Correlation of genetic variations with phenotypic differences

    • Identification of environment-specific adaptations

For A. salmonicida NQR, comparative analysis with both closely related marine vibrios and more distantly related bacteria can reveal adaptations specific to the cold marine environment. Special attention to residues involved in thermal stability and sodium binding would be particularly informative for understanding the evolution of this complex in different ecological niches.

What potential applications might emerge from engineered variants of A. salmonicida NQR subunit E?

Engineered NQR variants could lead to several innovative applications:

  • Bioenergetic applications:

    • Development of bacterial strains with enhanced energy conversion efficiency

    • Creation of systems for bioelectrochemical applications

    • Design of bacteria with altered salt tolerance

  • Biosensing platforms:

    • NADH/NAD⁺ ratio sensors for metabolic engineering

    • Sodium concentration biosensors

    • Electron transfer-based detection systems

  • Biocatalysis:

    • Engineered electron transfer systems for synthetic biology

    • Coupling of NQR to non-native enzymatic pathways

    • Development of redox biocatalysts for industrial applications

  • Biomedical applications:

    • Targets for new antibacterial compounds

    • Model systems for understanding human mitochondrial disorders

    • Tools for investigating ion transport mechanisms

  • Fundamental research tools:

    • Simplified model systems for electron transfer studies

    • Probes for membrane bioenergetics investigation

    • Platforms for testing theories of energy conservation

Engineering NQR variants with altered temperature optima or increased stability could provide valuable tools for biotechnological applications in extreme environments. Cold-active variants based on A. salmonicida NQR could be particularly useful for low-temperature bioprocessing applications.

How should researchers design control experiments for NQR functional studies?

Proper control experiments are critical for reliable NQR functional studies:

  • Negative controls:

    • Heat-denatured enzyme preparations

    • Known inactive variants (e.g., cofactor binding site mutants)

    • Preparations from knockout strains lacking specific subunits

    • Reactions without key substrates (NADH, quinones)

  • Positive controls:

    • Well-characterized homologous enzymes

    • Commercially available related enzymes when possible

    • Previously validated preparations as internal standards

  • Inhibitor controls:

    • Specific NQR inhibitors (HQNO, korormicin)

    • Graduated inhibitor concentrations for dose-response curves

    • Non-specific inhibitors for comparison (e.g., Ag⁺)

  • System controls:

    • Background reaction rates in buffer-only conditions

    • Non-enzymatic chemical reaction rates where applicable

    • Instrument calibration standards

  • Protein quality controls:

    • Size exclusion chromatography to verify complex integrity

    • Spectroscopic verification of cofactor content

    • Activity measurements over time to assess stability

For A. salmonicida NQR studies, temperature-matched controls are particularly important given its psychrophilic nature. Similarly, salt concentration must be carefully controlled given the Na⁺-dependence of the enzyme activity.

What collaborative approaches might accelerate progress in understanding A. salmonicida NQR subunit E?

Interdisciplinary collaboration can significantly advance this research area:

  • Multi-institution consortia:

    • Combining expertise in protein biochemistry, structural biology, and bioenergetics

    • Sharing specialized equipment and resources

    • Standardization of protocols and materials

  • Integration of diverse methodologies:

    • Combining computational with experimental approaches

    • Bridging structural, functional, and evolutionary studies

    • Linking molecular mechanisms to cellular physiology

  • Industry-academic partnerships:

    • Access to high-throughput screening capabilities

    • Application-focused research directions

    • Translation of findings to practical uses

  • Cross-species comparative studies:

    • Parallel analysis of NQR from different bacterial species

    • Correlation of sequence differences with functional properties

    • Understanding of adaptation to different ecological niches

  • Open science initiatives:

    • Pre-registration of study designs

    • Data sharing through public repositories

    • Open-access protocol dissemination

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.