Recombinant Aliivibrio salmonicida Probable intracellular septation protein A (VSAL_I1147)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; VSAL_I1147; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
VSAL_I1147
Target Protein Sequence
MKQILDFIPLIIFFALYKMYDIYTATGALIVATAVQLILTYVLYKKVEKMQLITFIMVTV FGGMTIFLHDDNFIKWKVTIVYAVFAAGLIIAQILGRPIIKGMLGKEVTLPDNKWNKINY AWILFFTACSIANLYVAFEMPLDVWVNFKVFGLLGLTFIYTLLTGMYVYKHMPKEKKEEQ E
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic context of Aliivibrio salmonicida and why is it significant for research?

Aliivibrio salmonicida (formerly Vibrio salmonicida) is the etiological agent of cold water vibriosis affecting sea-farmed fish species, including Atlantic salmon (Salmo salar), rainbow trout (Oncorhynchus mykiss), and Atlantic cod (Gadus morhua) . This bacterium has significant economic impact on aquaculture, though the disease is now largely controlled through vaccination .

The taxonomic reclassification from Vibrio to Aliivibrio occurred through phylogenetic analysis (Urbanczyk et al. 2007), positioning it in a group of marine bacteria that includes other species like Aliivibrio logei . Understanding the cell division proteins like VSAL_I1147 may provide insights into bacterial adaptation mechanisms in cold marine environments.

What expression systems are most effective for producing recombinant VSAL_I1147?

Based on available research, E. coli expression systems have been successfully used to produce recombinant VSAL_I1147 with an N-terminal His-tag . For optimal expression:

  • Vector selection: pET-based expression vectors under T7 promoter control are recommended for high-yield expression

  • Host strain optimization: BL21(DE3) derivatives optimize for membrane protein expression

  • Induction parameters:

    • Temperature: 16-18°C for membrane proteins

    • IPTG concentration: 0.1-0.5 mM

    • Duration: Extended expression (12-16 hours)

For membrane proteins like VSAL_I1147, solubilization requires careful detergent selection. A systematic approach testing multiple detergents is recommended:

Detergent ClassExamplesStarting Concentration
Non-ionicTriton X-100, DDM1%
ZwitterionicCHAPS, LDAO0.5-1%
Mild ionicSodium cholate0.5%

Each detergent should be evaluated for protein yield, purity, and retention of native structure through circular dichroism or fluorescence spectroscopy.

How can researchers assess the function of VSAL_I1147 in bacterial septation?

To investigate VSAL_I1147's role in septation:

  • Knockout studies: Generate gene deletions in Aliivibrio salmonicida using homologous recombination or CRISPR-Cas9

  • Complementation assays: Rescue knockout phenotypes with plasmid-expressed wild-type or mutant VSAL_I1147

  • Microscopy techniques:

    • Phase contrast to observe cell morphology changes

    • Fluorescence microscopy with membrane dyes (FM4-64)

    • Time-lapse imaging to track septation dynamics

  • Co-localization studies: Express fluorescently tagged VSAL_I1147 along with other known septation proteins to observe spatial and temporal relationships during cell division

Given that Aliivibrio salmonicida grows optimally at lower temperatures (7.5°C as noted in research), temperature-controlled imaging setups are essential for accurate in vivo characterization .

How might VSAL_I1147 interact with the quorum sensing systems in Aliivibrio salmonicida?

Aliivibrio salmonicida possesses complex quorum sensing (QS) systems that regulate biofilm formation and virulence through cell density-dependent mechanisms . While direct evidence linking VSAL_I1147 to QS hasn't been established in the available research, methodological approaches to investigate potential interactions include:

  • Transcriptomic analysis: Compare VSAL_I1147 expression levels between wild-type and QS mutant strains (ΔainS, ΔluxI, ΔrpoQ) using RNA-seq or qRT-PCR

  • Phenotypic assays with VSAL_I1147 overexpression or deletion in QS mutant backgrounds:

    • Biofilm formation (crystal violet staining)

    • Colony morphology (rugosity)

    • Motility assays (swimming, swarming)

  • Protein-protein interaction studies:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation with known QS regulators

    • Pull-down assays using His-tagged VSAL_I1147

The extensive QS research in Aliivibrio salmonicida has identified key regulators like LuxI, AinS, and RpoQ that influence biofilm formation in a cell density and temperature-dependent manner . The research shows that at high cell density, biofilm formation is downregulated through QS mechanisms, potentially involving structural proteins like VSAL_I1147.

What approaches can be used to investigate VSAL_I1147's potential role in Aliivibrio salmonicida pathogenesis?

To investigate VSAL_I1147's role in pathogenesis:

  • In vivo infection models:

    • Use Atlantic salmon as the natural host

    • Compare infection dynamics of wild-type vs. ΔVSAL_I1147 mutant

    • Measure bacterial loads, tissue distribution, and host survival

  • Immunological profiling:

    • Assess recombinant VSAL_I1147 immunogenicity

    • Develop monoclonal antibodies against VSAL_I1147

    • Test for cross-reactivity with related fish pathogens

  • Vaccine potential assessment:

    • Evaluate purified VSAL_I1147 as a subunit vaccine candidate

    • Compare with current oil-adjuvanted multi-component vaccines

    • Measure protective efficacy in challenge studies

Research has identified other Aliivibrio salmonicida membrane proteins, such as the 20 kDa peptidoglycan-associated lipoprotein (Pal) as immunogenic components recognized by antibodies from infected fish . Similar methodologies could be applied to assess VSAL_I1147's immunogenicity.

How does VSAL_I1147 compare to homologous septation proteins in other bacterial species?

To conduct comprehensive comparative analyses:

  • Phylogenetic analysis workflow:

    • BLAST search to identify homologs across bacterial species

    • Multiple sequence alignment using MUSCLE or CLUSTALΩ

    • Construction of phylogenetic trees (Maximum Likelihood)

    • Analysis of evolutionary conservation patterns

  • Structural comparison approaches:

    • Homology modeling of VSAL_I1147 using related structures as templates

    • Domain architecture analysis

    • Identification of conserved functional residues

    • Virtual docking studies with potential interaction partners

  • Complementation studies:

    • Express VSAL_I1147 in model organisms with knockouts of homologous genes

    • Assess functional conservation by measuring restoration of normal septation

Based on homology to other bacterial septation proteins, VSAL_I1147 likely functions in the membrane during cell division, potentially participating in septum formation or regulation .

How can transcriptomic and proteomic approaches be combined to understand VSAL_I1147 regulation?

Integrative multi-omics approaches provide comprehensive understanding:

  • Transcriptomic analysis:

    • RNA-seq under various conditions (temperature, growth phase, host interaction)

    • Identification of co-expressed gene clusters

    • Promoter analysis for regulatory elements

  • Proteomic approaches:

    • Targeted proteomics (MRM-MS) to quantify VSAL_I1147 levels

    • Global proteomics to identify co-regulated proteins

    • Phosphoproteomics to detect potential post-translational modifications

  • Data integration strategies:

    • Correlation analysis between transcript and protein levels

    • Network analysis to identify regulatory hubs

    • Pathway enrichment to place VSAL_I1147 in functional contexts

Previous research with Aliivibrio salmonicida has utilized transcriptomic approaches to study quorum sensing mutants (ΔlitR and ΔrpoQ), revealing differential expression of genes involved in motility, adhesion, and biofilm formation . Similar approaches could position VSAL_I1147 within these regulatory networks.

What methods are most effective for structural characterization of membrane-associated proteins like VSAL_I1147?

For structural studies of VSAL_I1147:

The amino acid sequence of VSAL_I1147 suggests transmembrane regions that would require specialized approaches for structural characterization .

What are the key unanswered questions about VSAL_I1147 that warrant further investigation?

Several critical research questions remain:

  • Functional characterization:

    • Precise molecular function during bacterial cell division

    • Interaction partners in the septation machinery

    • Regulation in response to environmental signals

  • Pathogenesis relevance:

    • Contribution to bacterial fitness during infection

    • Potential as a diagnostic marker or vaccine component

    • Role in environmental persistence outside the host

  • Evolutionary significance:

    • Selection pressures shaping VSAL_I1147 in marine pathogens

    • Functional divergence from homologs in other Vibrio species

    • Adaptation to cold-water environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.