Definition:
Lgt (lipoprotein diacylglyceryl transferase) catalyzes the diacylglyceryl modification of prelipoproteins, a key step in bacterial lipoprotein maturation. In A. salmonicida, a fish pathogen causing cold-water vibriosis, this enzyme is essential for membrane integrity and virulence .
Recombinant Production:
The recombinant Lgt protein (Uniprot ID: B6EMX8) is expressed in heterologous systems (e.g., E. coli) and purified to >85% purity (SDS-PAGE) . It retains functional activity for enzymatic assays and structural studies.
Sequence: MSQGYLNFPHIDPILFQIGPLAIRWYGLMYLFGFMFALWLANKRADKPNSGWTKDQVSDL... (partial sequence from )
Function: Transfers diacylglyceryl groups from phosphatidylglycerol to the +1 cysteine of prelipoproteins .
Role in Pathogenicity: Critical for outer membrane (OM) stability and antibiotic resistance .
Mechanism: Inhibiting Lgt disrupts OM biogenesis, leading to bacterial death .
Advantage Over Other Targets: Unlike LspA or LolCDE inhibitors, Lgt inhibition is not circumvented by lpp deletion (a major resistance mechanism) .
Role in A. salmonicida: Lgt is essential for membrane integrity and survival in host environments .
Moonlighting Enzymes: While not directly linked to Lgt, A. salmonicida employs other enzymes (e.g., LPMOs) for pathogenicity .
KEGG: vsa:VSAL_I0572
STRING: 316275.VSAL_I0572
Prolipoprotein diacylglyceryl transferase (Lgt) from Aliivibrio salmonicida is an enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins, which are critical for bacterial growth and pathogenesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in the lipobox motif of preprolipoproteins via a thioether bond . This modification anchors lipoproteins to the membrane and is essential for bacterial envelope integrity. In Aliivibrio salmonicida, the lgt gene (VSAL_I0572) encodes the full-length 283-amino acid protein with a UniProt accession number of B6EMX8 .
Aliivibrio salmonicida Lgt (UniProt: B6EMX8) is classified as a transferase with the Enzyme Commission (EC) number 2.4.99.- . The protein consists of 283 amino acids with a sequence that includes multiple transmembrane domains, reflective of its localization in the inner membrane. The primary sequence includes highly conserved regions for substrate binding and catalysis. Structural analysis suggests the enzyme contains multiple membrane-spanning regions that position the active site to access both the phosphatidylglycerol substrate within the membrane and the cysteine-containing lipobox motif of preprolipoprotein substrates.
Lgt functions as part of a three-enzyme cascade in Gram-negative bacteria that processes lipoproteins for correct localization and function. The pathway begins when preprolipoproteins containing a signal peptide with a conserved lipobox motif ([LVI][ASTVI][GAS]C) are secreted through the inner membrane via the Sec or Tat pathways . Lgt then attaches a diacylglyceryl moiety to the thiol group of the conserved cysteine. Subsequently, LspA (lipoprotein signal peptidase) cleaves the signal peptide N-terminal to the modified cysteine, and Lnt (lipoprotein N-acyl transferase) adds a third acyl chain to the amino group of the N-terminal cysteine via an amide linkage . This maturation process is essential for proper lipoprotein transport and function in bacterial cell envelopes.
Recombinant Aliivibrio salmonicida Lgt can serve as a valuable tool in antibiotic development through several approaches. Researchers can establish in vitro biochemical assays to screen for novel inhibitors by measuring the release of glycerol phosphate during the enzymatic reaction . High-throughput screening platforms can be developed using the recombinant protein to identify compounds that disrupt Lgt activity. Since Lgt inhibition leads to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics in Gram-negative bacteria, compounds identified can be further developed as standalone antimicrobials or adjuvants to enhance the efficacy of existing antibiotics . Additionally, structural studies with the recombinant protein can inform structure-based drug design approaches.
Multiple complementary approaches can detect Lgt inhibition in bacterial cells. One robust method involves monitoring the accumulation of unmodified prolipoproteins (UPLP) using SDS-PAGE analysis, as Lgt inhibition prevents diacylglyceryl modification . Western blotting with antibodies against specific lipoproteins (such as Pal or Lpp in E. coli models) can reveal shifts in migration patterns characteristic of unmodified forms. Researchers can also assess membrane integrity using dye uptake assays (e.g., with propidium iodide or NPN) since Lgt inhibition compromises outer membrane integrity. Functional assays measuring sensitivity to serum killing or synergy with membrane-active antibiotics provide indirect evidence of Lgt inhibition. For confirmatory studies, mass spectrometry can precisely characterize lipoprotein modifications (or their absence) following potential inhibitor treatment .
Research indicates that Lgt inhibition or deletion significantly disrupts peptidoglycan-lipoprotein interactions, with profound consequences for bacterial cell envelope integrity. When Lgt is inhibited or depleted, there is a notable reduction in peptidoglycan-associated prolipoproteins (PAP) in the cell envelope . Studies with E. coli demonstrate that while unmodified prolipoproteins (UPLP) can still associate with peptidoglycan to some extent, this association is significantly less efficient than for diacylglyceryl-modified forms . The reduced peptidoglycan tethering compromises cell envelope stiffness and stability. Interestingly, unlike inhibition of downstream lipoprotein processing enzymes like LspA, where deletion of major lipoproteins (like lpp) can rescue growth, Lpp actually provides protection against Lgt inhibition, suggesting complex relationships between lipoprotein modification and peptidoglycan association .
Recombinant Aliivibrio salmonicida Lgt should be stored at -20°C in Tris-based buffer with 50% glycerol for general purposes, but for extended storage, conservation at -80°C is recommended . Working aliquots can be maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles, which can compromise protein activity and stability . When handling the protein, maintain sterile conditions and use appropriate protective equipment as with all recombinant proteins. For experimental work, consider using fresh dilutions from stock solutions rather than repeatedly freezing and thawing the same aliquot. If the protein contains any affinity tags (which may be determined during the production process), take these into account when designing experiments, as they may influence protein behavior or require specific buffer conditions for optimal stability .
A robust biochemical assay for measuring Aliivibrio salmonicida Lgt activity can be developed based on the detection of glycerol phosphate release during the enzymatic reaction. Researchers can adapt the coupled luciferase assay described for E. coli Lgt , using a synthetic peptide substrate derived from an A. salmonicida lipoprotein containing the conserved lipobox motif with the critical cysteine residue. The assay requires phosphatidylglycerol as the diacylglyceryl donor substrate. As Lgt catalyzes the transfer of diacylglyceryl to the peptide substrate, glycerol phosphate is released and can be detected through a coupled enzymatic reaction . For quantitative assessment of inhibitors, IC50 values can be determined by measuring enzyme activity across a range of inhibitor concentrations. Control reactions should include a mutant peptide substrate with the cysteine substituted with alanine, which prevents modification and serves as a negative control .
For producing recombinant Aliivibrio salmonicida Lgt, researchers should consider several expression systems based on the protein's membrane-associated nature. E. coli-based systems with specialized strains like C41(DE3) or C43(DE3) that are engineered for membrane protein expression can be effective when combined with vectors containing mild promoters to prevent toxic accumulation. Codon optimization for E. coli is advisable when expressing Aliivibrio proteins. For larger scale production, insect cell expression systems (Sf9 or Hi5 cells with baculovirus vectors) often yield properly folded membrane proteins with higher activity. Purification typically requires detergent solubilization (mild detergents like DDM or LMNG) followed by affinity chromatography using appropriately positioned tags that don't interfere with the active site. For structural studies, incorporation of stabilizing mutations or fusion partners may enhance protein stability without compromising activity.
Studying Aliivibrio salmonicida Lgt offers significant insights into bacterial pathogenesis, particularly for fish pathogens. A. salmonicida, the causative agent of cold-water vibriosis in Atlantic salmon and other fish species, relies on proper lipoprotein processing for virulence and host colonization. Research on its Lgt provides a window into how lipoprotein maturation contributes to outer membrane integrity, host immune evasion, and adaptation to the fish host environment. Comparative studies with Lgt from human pathogens like E. coli can illuminate conserved and divergent mechanisms in lipoprotein processing across different host-pathogen systems. This understanding can guide the development of targeted antimicrobial strategies for aquaculture applications while providing broader insights into how Gram-negative bacteria adapt their envelope composition during infection processes. The psychrophilic nature of A. salmonicida also offers opportunities to investigate how lipoprotein processing systems adapt to function at lower temperatures.
Cross-species activity testing of E. coli Lgt inhibitors against Aliivibrio salmonicida Lgt would provide valuable data on inhibitor specificity and evolutionary conservation of binding sites. While the recent identification of novel inhibitors against E. coli Lgt (with IC50 values between 0.18-0.93 μM) represents a significant advance, their efficacy against A. salmonicida Lgt remains to be determined through comparative biochemical assays. Researchers should establish parallel in vitro assays using both enzymes to generate comparative IC50 values. Differences in inhibitory profiles could highlight structural variations in the enzyme's active site that might be exploited for species-selective targeting. Additionally, molecular docking studies and mutagenesis experiments can identify key residues responsible for any observed differences in inhibitor binding. This comparative approach not only advances antimicrobial development but also enhances our understanding of evolutionary conservation in bacterial lipoprotein biosynthesis pathways.
Advanced genetic approaches to study Lgt function in Aliivibrio salmonicida should focus on creating conditional mutants given the likely essential nature of this gene. Researchers can implement an arabinose-inducible promoter system similar to that used in E. coli studies to generate a conditional lgt depletion strain. CRISPR-Cas9 techniques optimized for Vibrionaceae can facilitate precise genome editing for introducing point mutations to assess the contributions of specific residues to enzyme function. Complementation studies with modified lgt variants can determine essential domains and residues. For functional genomics approaches, RNA-seq analysis comparing wild-type and lgt-depleted conditions would identify compensatory responses and affected pathways. Additionally, transposon mutagenesis screens in sensitized backgrounds (e.g., partial lgt depletion) could uncover genetic interactions and synthetic lethality relationships. These approaches together would create a comprehensive understanding of Lgt's role in A. salmonicida physiology and potential vulnerabilities for antimicrobial development.
Structural studies of Aliivibrio salmonicida Lgt would significantly accelerate structure-based drug design efforts targeting this enzyme. Researchers should pursue high-resolution structural determination through X-ray crystallography or cryo-electron microscopy, potentially using lipid nanodiscs to maintain the native membrane environment. These structures would reveal the precise architecture of the active site, substrate binding pockets, and potential allosteric sites unique to A. salmonicida Lgt. Molecular dynamics simulations could further characterize the conformational changes during catalysis and inhibitor binding. Co-crystallization with substrate analogs or already identified E. coli Lgt inhibitors would provide crucial insights into the molecular basis of inhibition. Comparing these structures with those from human pathogens would highlight conserved pockets for broad-spectrum targeting or unique features for species-selective inhibition. This structural information would guide medicinal chemistry efforts to optimize lead compounds for improved potency, selectivity, and pharmacokinetic properties.
Understanding potential resistance mechanisms against Lgt inhibitors requires systematic investigation of several pathways. Unlike inhibitors targeting other steps in lipoprotein biosynthesis, deletion of major outer membrane lipoproteins (such as lpp) does not confer resistance to Lgt inhibition , suggesting different resistance mechanisms may emerge. Researchers should conduct long-term evolution experiments with sub-lethal inhibitor concentrations to identify spontaneous resistant mutants, followed by whole-genome sequencing to determine resistance-conferring mutations. Potential mechanisms might include target modifications that preserve function while reducing inhibitor binding, upregulation of efflux pumps, or metabolic adaptations that reduce dependence on specific lipoproteins. Transcriptomic and proteomic analyses of resistant strains would reveal compensatory pathways activated upon Lgt inhibition. To address potential resistance, researchers should develop combination strategies targeting multiple steps in envelope biogenesis pathways simultaneously or design inhibitors targeting highly conserved regions of Lgt where mutations would likely compromise enzyme function .
Working with recombinant Aliivibrio salmonicida Lgt presents several technical challenges inherent to membrane proteins. Low expression yields often occur due to cytotoxicity; researchers can address this by using tightly controlled expression systems, lower induction temperatures (16-20°C), and specialized E. coli strains designed for membrane protein expression. Protein aggregation during purification can be minimized by screening multiple detergents (DDM, LMNG, or Brij-35) for optimal solubilization and including stabilizing agents like glycerol and specific lipids in purification buffers . Activity loss during storage can be prevented by avoiding repeated freeze-thaw cycles and storing aliquots in high glycerol concentration (50%) at -80°C for long-term preservation . For functional assays, background phosphate contamination can interfere with activity measurements; researchers should implement stringent phosphate-free conditions and appropriate controls. When establishing activity assays, substrate preparation is crucial—phosphatidylglycerol must be properly solubilized to ensure accessibility while maintaining enzyme activity.
Validating proper folding and functionality of recombinant Aliivibrio salmonicida Lgt requires multiple complementary approaches. Researchers should begin with biophysical characterization including circular dichroism spectroscopy to assess secondary structure content and thermal stability measurements to determine if the protein exhibits cooperative unfolding characteristic of well-folded proteins. Size-exclusion chromatography coupled with multi-angle light scattering can confirm that the protein exists in the expected oligomeric state rather than forming aggregates. The definitive test for functionality is an enzymatic activity assay measuring the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate containing the conserved cysteine residue, with glycerol phosphate release as the readout . A properly designed negative control using a peptide with cysteine mutated to alanine should show no activity . Additionally, binding studies with known Lgt inhibitors identified from E. coli studies can provide further evidence of correct folding if the protein demonstrates expected inhibition profiles.
Designing optimal substrate peptides for Aliivibrio salmonicida Lgt activity assays requires careful consideration of several factors. The peptide should contain the canonical lipobox motif ([LVI][ASTVI][GAS]C) with the conserved cysteine residue that serves as the site for diacylglyceryl attachment . Ideally, researchers should base the peptide sequence on a native A. salmonicida lipoprotein substrate for physiological relevance. The peptide length should be sufficient to ensure proper enzyme-substrate interaction (typically 10-15 amino acids) while remaining soluble in aqueous buffers. N-terminal modifications may be necessary to mimic the natural presentation of the lipobox motif in preprolipoproteins. Researchers should synthesize both the wild-type peptide and a control peptide with cysteine substituted with alanine to serve as a negative control . Fluorescent or isotopically labeled peptides can facilitate detection in high-sensitivity assays. Additionally, peptide solubility in assay conditions must be confirmed, as hydrophobic sequences may aggregate and give misleading results.
Interpreting changes in Aliivibrio salmonicida Lgt activity across different experimental conditions requires careful consideration of multiple factors that can influence enzyme performance. Researchers should establish a standardized baseline activity under optimal conditions (appropriate temperature, pH, ionic strength, and substrate concentrations) before testing variables. When comparing activity levels, statistical analysis should account for both technical and biological replicates. Temperature effects are particularly relevant for A. salmonicida Lgt given the psychrophilic nature of this organism—activity profiles at different temperatures may reveal adaptations to cold environments. When testing potential inhibitors, dose-response curves should be generated to determine IC50 values, and inhibition mechanisms (competitive, non-competitive, or uncompetitive) should be established through kinetic analysis . Researchers should control for non-specific effects such as protein aggregation or membrane disruption that could masquerade as specific inhibition. Finally, correlations between in vitro activity measurements and in vivo phenotypes should be established to ensure biological relevance of the findings.
Statistical analysis of Lgt inhibition data requires rigorous approaches to ensure reliability and reproducibility. For dose-response experiments, researchers should use nonlinear regression to fit inhibition curves and determine IC50 values with 95% confidence intervals . Four-parameter logistic regression models typically provide good fits for enzyme inhibition data. When comparing multiple inhibitors, one-way ANOVA followed by appropriate post-hoc tests (such as Tukey's or Dunnett's) can determine significant differences between compounds. For mechanism of action studies, linear regression analysis of Lineweaver-Burk or Hanes-Woolf plots can distinguish between competitive, non-competitive, and uncompetitive inhibition. Time-dependent inhibition should be analyzed using exponential decay models to extract kinact/Ki values for slow-binding inhibitors. Robust statistics that are less sensitive to outliers (such as median-based methods) may be appropriate when assay variability is high. For all analyses, researchers should report effect sizes along with p-values and validate results across multiple independent experiments to ensure reproducibility.
Establishing meaningful correlations between in vitro Lgt inhibition and in vivo antibacterial effects requires a systematic approach bridging biochemical, cellular, and whole-organism levels. Researchers should first determine IC50 values for inhibitors against purified recombinant Lgt in biochemical assays , then measure minimum inhibitory concentrations (MICs) against wild-type A. salmonicida and derived strains with modified Lgt expression levels. A pharmacodynamic index (PD index) correlating IC50 to MIC ratios across multiple compounds can identify whether biochemical potency translates to cellular activity. Western blot analysis tracking accumulation of unmodified prolipoproteins can confirm on-target activity in bacterial cells . For compounds showing promising activity, membrane permeability assays and lipidomic analyses can establish mechanism-specific effects. In more advanced stages, fish infection models can assess in vivo efficacy, with pharmacokinetic studies determining whether compounds achieve sufficient concentrations at sites of infection. This multilevel approach enables researchers to optimize compounds with both potent biochemical activity and effective antibacterial properties in relevant biological systems.
Targeting Lgt represents a promising approach for treating Aliivibrio salmonicida infections in aquaculture settings due to several advantageous features. A. salmonicida causes cold-water vibriosis, a significant disease in farmed Atlantic salmon that results in substantial economic losses. Lgt inhibition offers a novel mechanism of action distinct from conventional antibiotics, potentially addressing antimicrobial resistance concerns in aquaculture. Since Lgt is essential for membrane integrity, inhibitors would likely have bactericidal activity rather than bacteriostatic effects, potentially leading to more rapid clearance of infections . The increased sensitivity to serum killing observed with Lgt inhibition would synergize with the fish's immune response, potentially enhancing treatment efficacy . Additionally, the outer membrane permeabilization effect could increase susceptibility to co-administered antibiotics at lower doses, reducing environmental impact. Important considerations include developing compounds with appropriate pharmacokinetics for delivery in feed, minimal toxicity to fish and beneficial microbiota, and stability in aquatic environments. Field trials would need to assess efficacy under variable temperature conditions relevant to salmon farming.
Functional studies of Aliivibrio salmonicida Lgt can significantly advance vaccine development strategies against cold-water vibriosis through multiple mechanisms. Understanding which lipoproteins are processed by Lgt in A. salmonicida can identify surface-exposed antigens that are essential for bacterial virulence and highly immunogenic. These lipoproteins could serve as subunit vaccine candidates or targets for attenuated live vaccine development. Research demonstrating that Lgt inhibition leads to membrane permeabilization suggests that rationally designed Lgt-deficient strains (with carefully controlled expression levels) could serve as attenuated live vaccines that maintain immunogenicity while lacking pathogenicity. Additionally, the increased serum sensitivity following Lgt depletion indicates that antibodies targeting lipoproteins may enhance complement-mediated killing, a desirable vaccine outcome. Comparative immunoproteomic studies of wild-type versus Lgt-depleted strains could identify which lipoproteins trigger protective immune responses in fish. This knowledge would guide the design of next-generation vaccines with improved efficacy and safety profiles for aquaculture applications.
Environmental factors significantly influence Lgt function in Aliivibrio salmonicida during infection cycles in aquaculture settings, with important implications for pathogenesis and treatment strategies. Temperature fluctuations represent a primary factor, as A. salmonicida is a psychrophilic pathogen optimized for cold-water environments. Researchers should investigate how Lgt enzymatic activity and substrate specificity change across temperature ranges encountered in salmon farming (4-16°C). Salinity variations may affect membrane composition and consequently Lgt substrate availability, while pH shifts could alter enzyme conformation and activity. Nutrient availability during infection likely influences the expression of Lgt and its lipoprotein substrates through regulatory networks responding to host environments. Importantly, seasonal variations in these parameters could explain temporal patterns in disease outbreaks. For comprehensive understanding, researchers should employ temperature-controlled enzyme assays, transcriptomic analysis under various environmental conditions, and infection models that replicate different environmental scenarios. This knowledge could inform optimal timing for preventive measures and identify environmental conditions where Lgt inhibitors might show enhanced or reduced efficacy.
Integrating structural biology and molecular simulation approaches can substantially enhance understanding of Aliivibrio salmonicida Lgt through multiple complementary techniques. Researchers should pursue high-resolution structures using cryo-electron microscopy or X-ray crystallography, potentially employing lipid nanodiscs to maintain the protein in a membrane-like environment. These structures would reveal the spatial arrangement of catalytic residues, substrate binding pockets, and conformational states. Molecular dynamics simulations can then explore how the enzyme interacts with lipid bilayers, captures phosphatidylglycerol substrates, and accommodates diverse lipoprotein substrates. Binding free energy calculations can identify hot spots for inhibitor design and predict how mutations might affect inhibitor sensitivity. Comparative modeling with other bacterial Lgt structures can highlight conserved features and species-specific adaptations, particularly those related to A. salmonicida's psychrophilic lifestyle. Coarse-grained simulations can investigate longer-timescale processes like membrane association and conformational changes during catalysis. This integrated structural biology approach would accelerate rational drug design efforts and provide mechanistic insights into the fundamental biology of bacterial lipoprotein processing.
Advancing Lgt research requires interdisciplinary collaboration across multiple scientific domains. Biochemists and structural biologists should partner to solve the three-dimensional structure of A. salmonicida Lgt and characterize its catalytic mechanism. Medicinal chemists and computational biologists can leverage these structures for rational design of inhibitors, while microbiologists assess their effects on bacterial physiology and virulence. Immunologists contribute by investigating how Lgt-processed lipoproteins interact with fish immune systems, informing vaccine development. Systems biologists can map the networks of lipoproteins processed by Lgt and their functions in bacterial pathogenesis. Environmental microbiologists provide insights into how changing aquatic conditions affect Lgt function and expression. Aquaculture specialists and veterinarians are essential for translating laboratory findings into practical applications for fish health management. Finally, biotechnologists can explore how engineered Lgt variants might be used in protein engineering applications. This multidisciplinary approach ensures that basic science discoveries about this fascinating enzyme translate into meaningful applications for aquaculture disease management and beyond.