Recombinant Aliivibrio salmonicida Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes. We will then fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery information, please consult your local distributor.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as an additional charge will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
htpX; VSAL_I1322; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
htpX
Target Protein Sequence
MKRIALFLATNLAVMIVFSIVLNIVYAVTGIQQGSLSGLLVMAVLFGFGGSLVSLLMSKK MALRSVGGEVIEQPRNETEHWLMETVSRQAQQVGIGMPTVAIYDSPDMNAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMITMTLMQGVVNTFVIFLSRMIANAVSG FTSNDEEGEGEGGSFMTYFIVSTVLEIAFGFLASFLTMWFSRHREFYADAGAANLVGKDK MIAALERLRMGQESQLEGSMMAFGINGKKSLTELLMSHPPLEKRINALRQL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aliivibrio salmonicida Protease HtpX and what is its primary function?

Aliivibrio salmonicida Protease HtpX (htpX) is a membrane-bound zinc metalloproteinase belonging to the M48 family. It is classified as a heat shock protein and functions primarily in the proteolytic quality control of membrane proteins . In bacterial cells, HtpX participates in the degradation of misfolded or damaged membrane proteins, playing a crucial role in maintaining membrane integrity during stress conditions . The protein consists of approximately 290-291 amino acids in A. salmonicida strains and contains multiple transmembrane segments . HtpX has been implicated in bacterial stress response mechanisms and may contribute to virulence in pathogenic bacteria like A. salmonicida, which causes significant economic losses in salmon farming .

What are the structural characteristics of Protease HtpX?

Protease HtpX in A. salmonicida is characterized by:

  • Full protein length of 290-291 amino acids

  • Four hydrophobic regions (H1-H4) that likely function as transmembrane segments, although there is controversy regarding whether the two C-terminal regions are membrane-embedded

  • Contains a zinc-binding domain typical of metalloproteinases

  • Has a conserved HEXXH motif characteristic of zinc metalloproteases

  • Predominantly hydrophobic amino acid composition, consistent with its membrane localization

The amino acid sequence shows characteristic features of membrane proteins, including multiple hydrophobic segments and charged residues at predicted membrane interfaces. The protein appears to undergo self-cleavage in the presence of zinc, suggesting autoprotease activity that may be important for its function or regulation .

How is HtpX gene expression regulated in bacteria?

HtpX expression is regulated through several mechanisms:

  • Temperature-responsive regulation: RNA-seq studies have shown that htpX expression in A. salmonicida is significantly affected by water temperature

  • Stress-responsive regulation: As a heat shock protein, its expression increases during various stress conditions including heat shock, oxidative stress, and membrane protein overloading

  • Potential sigma factor control: In E. coli, HtpX has been associated with the σE regulon, which responds to envelope stress

  • Possible coordinated regulation with FtsH protease: HtpX appears to work in conjunction with the ATP-dependent protease FtsH in membrane protein quality control, suggesting potential co-regulation

Research indicates that in psychrophilic bacteria like A. salmonicida, temperature plays a particularly important role in regulating htpX expression, which may contribute to its adaptation to cold environments and its pathogenicity in fish hosts .

What is the taxonomic classification and distribution of HtpX?

HtpX is widely distributed across bacterial species, with homologs found in:

  • Gamma-proteobacteria like Aliivibrio, Aeromonas, Escherichia, and Vibrio species

  • Other bacterial phyla, suggesting evolutionary conservation of this proteolytic system

  • Particularly important in psychrophilic pathogens like A. salmonicida

The gene is designated as htpX with various species-specific locus tags (e.g., VSAL_I1322 in A. salmonicida strain LFI1238, ASA_2873 in A. salmonicida strain A449) .

What are the most effective methods for recombinant expression of HtpX?

Successful recombinant expression of HtpX requires careful consideration of expression systems and conditions:

Expression Systems Comparison:

Expression SystemAdvantagesChallengesTag Options
E. coliHigh yield, cost-effective, rapid expressionPotential toxicity, inclusion body formationHis, GST, MBP
BaculovirusBetter for membrane proteins, eukaryotic processingMore complex, longer production timeHis, FLAG
YeastGood for eukaryotic processing, high yieldLonger production timeHis, FLAG
Mammalian cellsNative-like folding and modificationsLow yield, expensive, complexHis, Myc, FLAG

Methodological considerations:

  • Use solubility-enhancing fusion tags to overcome toxicity issues. For A. salmonicida proteins, maltose-binding protein (MBP) and glutathione S-transferase (GST) have proven effective in overcoming moderate toxicity in E. coli .

  • Consider expressing the mature form (without leader peptides) for improved activity. Studies have shown that truncated forms without leader peptides exhibit significantly higher activity compared to full-length proteins .

  • For HtpX, which undergoes self-degradation upon cell disruption, purification under denaturing conditions followed by refolding in the presence of zinc chelators has proven effective .

  • When expressing in E. coli, use low-temperature induction (16-18°C) to improve proper folding and solubility of membrane proteins like HtpX .

  • Include appropriate protease inhibitors during purification to prevent degradation, particularly important for self-cleaving proteases like HtpX .

How can researchers establish reliable in vivo HtpX protease activity assays?

Establishing reliable in vivo protease activity assays for HtpX has been challenging due to the lack of identified physiological substrates. Recent methodological advances include:

  • Development of model substrates: Construct fusion proteins containing known or suspected HtpX cleavage sites flanked by reporter domains for easy detection .

  • In vivo semiquantitative assay system: This approach allows for detection of differential protease activities of wild-type HtpX versus mutants with alterations in conserved regions .

  • RNA interference approach: Creating htpX-RNAi strains and comparing their phenotypes (growth, adhesion, biofilm formation) with wild-type strains can indirectly measure HtpX activity .

  • Growth curve measurements: Compare growth of wild-type and htpX-deficient strains under various stress conditions to evaluate the physiological impact of HtpX activity .

  • Western blot detection of substrate degradation: Express both HtpX and potential substrate proteins in vivo and monitor substrate degradation via Western blotting .

Key considerations for assay development:

  • Include appropriate controls (protease-inactive HtpX mutants)

  • Account for membrane localization in assay design

  • Ensure zinc availability as HtpX is zinc-dependent

  • Consider temperature conditions, especially for psychrophilic A. salmonicida HtpX

What purification strategies yield high-quality recombinant HtpX?

Purification of active HtpX presents unique challenges due to its membrane-bound nature and self-cleaving activity. Effective strategies include:

  • Denaturing purification followed by refolding:

    • Solubilize membranes with strong detergents

    • Purify under denaturing conditions using affinity chromatography

    • Refold gradually in the presence of zinc chelators

    • Add zinc back for activity assays

  • Fusion with solubility enhancers:

    • Express as fusions with Hero proteins, which have shown promising results in stabilizing challenging proteins

    • Use MBP or GST tags, which have proven effective for A. salmonicida proteins

  • DNA removal strategy:

    • Treat lysates with nucleases that can be inactivated by reducing agents to avoid nuclease contamination in final preparations

  • Storage optimization:

    • Store in 50% glycerol at -20°C/-80°C to maintain stability

    • Avoid repeated freeze-thaw cycles

    • Consider keeping working aliquots at 4°C for up to one week

  • Purification yield enhancement:

    • Use periplasmic targeting sequences if appropriate

    • Consider IMAC (immobilized metal affinity chromatography) for His-tagged versions

    • Include zinc in purification buffers to stabilize the metalloprotease domain

How does HtpX contribute to bacterial virulence and pathogenesis?

HtpX appears to play significant roles in bacterial virulence and pathogenesis, particularly in pathogens like A. salmonicida:

Experimental approaches to study HtpX's role in virulence:

  • Generate htpX knockout or knockdown strains and assess virulence in fish models

  • Compare transcriptomes of wild-type and htpX-deficient strains during infection

  • Identify HtpX substrates that may be directly involved in virulence

What are the current challenges in identifying physiological substrates of HtpX?

Identifying the physiological substrates of HtpX remains challenging for several reasons:

  • Membrane protein context: HtpX substrates are likely membrane proteins, which are difficult to study using conventional proteomics approaches .

  • Rapid degradation: HtpX-cleaved fragments may be rapidly degraded by other proteases, making detection difficult .

  • Conditional activity: HtpX may only cleave certain substrates under specific stress conditions .

  • Redundancy in proteolytic systems: Overlapping functions with other proteases like FtsH may mask phenotypes in single-protease knockout studies .

Methodological approaches to overcome these challenges:

  • Protease-inactive mutants: Generate catalytically inactive HtpX mutants to act as substrate traps .

  • Comparative proteomics: Compare membrane proteomes between wild-type and htpX-deficient strains under various stress conditions.

  • Model substrate development: Design reporter substrates with potential HtpX cleavage sites to validate activity in vivo .

  • Co-immunoprecipitation studies: Identify interacting partners that may be potential substrates.

  • In vitro validation: Confirm direct cleavage of candidate substrates using purified HtpX under controlled conditions.

How can fusion tags enhance stability of recombinant HtpX for structural studies?

Recent advances in protein stabilization technologies offer promising approaches for enhancing recombinant HtpX stability:

  • Hero protein tags: Recently discovered unstructured heat-resistant obscure (Hero) proteins can significantly enhance protein stability when used as fusion tags. They have been shown to protect various "client" proteins from stresses including heat, freeze-thaw cycles, and protease treatment .

  • Comparative fusion tag performance for destabilized proteins:

Fusion TagProtection Against HeatProtection Against Freeze-ThawProtection Against ProteasesEffect on Activity
Hero9StrongStrongModerateUsually maintains
Hero11VariableStrongStrongMay reduce
GSTModerateWeakWeakVariable
MBPGoodModerateModerateUsually maintains
  • Placement optimization: N-terminal Hero tags showed better protection than C-terminal tags for model proteins .

  • Selection strategy: Different Hero proteins show preference for different client proteins, suggesting testing multiple Hero variants is necessary to identify optimal combinations .

  • Application to membrane proteins: Hero tags may be particularly valuable for stabilizing membrane proteins like HtpX that are prone to aggregation or self-cleavage .

Methodological considerations:

  • Include proper linkers between Hero tags and HtpX

  • Test multiple Hero variants (Hero9, 11, 20) to determine optimal protection

  • Consider tandem Hero repeats for enhanced stabilization

  • Evaluate impact on enzymatic activity alongside stability improvements

What is the relationship between HtpX and other membrane proteases in bacterial quality control?

HtpX functions within a complex network of membrane proteases involved in protein quality control:

  • Cooperation with FtsH: HtpX appears to work in conjunction with FtsH, an ATP-dependent membrane protease. When FtsH is compromised, HtpX becomes particularly important for cell viability, suggesting partially overlapping functions .

  • Complementary substrate specificity: While FtsH requires ATP for activity, HtpX is ATP-independent but zinc-dependent, potentially allowing for energy-efficient degradation of certain substrates .

  • Integration in the membrane proteolytic network:

ProteaseFamilyEnergy RequirementSubstrate RangeCoordination with HtpX
HtpXM48 zinc metalloproteaseZinc-dependentMembrane proteinsPrimary focus
FtsHAAA+ ATP-dependentATP-dependentMembrane/cytosolic proteinsComplementary/overlapping
SPPAspartic proteaseATP-independentSignal peptidesPotential downstream processor
RhomboidSerine proteaseATP-independentTransmembrane substratesParallel pathway
  • Potential processing pathways: HtpX may initiate degradation of certain membrane proteins that are then further processed by other proteases like FtsH .

  • Stress response coordination: The expression and activity of these proteases appear to be coordinated during stress responses, suggesting a regulated network rather than independent activities .

Future research directions include identifying the specific substrates unique to HtpX versus those shared with FtsH, and elucidating the precise molecular mechanisms by which these proteases recognize their substrates within the membrane environment.

How can researchers address common challenges in working with recombinant HtpX?

Working with recombinant HtpX presents several technical challenges. Here are methodological approaches to overcome them:

  • Self-degradation during purification:

    • Purify under denaturing conditions with 8M urea or 6M guanidine hydrochloride

    • Include zinc chelators (EDTA, 1,10-phenanthroline) during initial purification

    • Refold gradually by dialysis against decreasing concentrations of denaturant

    • Add zinc back only for activity assays

  • Low solubility:

    • Use solubility-enhancing fusion tags like MBP or GST

    • Consider Hero protein fusions, which have shown promise for difficult proteins

    • Express at lower temperatures (16-18°C)

    • Include glycerol (10-20%) in purification buffers

  • Toxicity to expression hosts:

    • Use tightly controlled inducible promoters

    • Express as larger fusion proteins to reduce toxicity

    • Consider Lemo21(DE3) or other E. coli strains designed for toxic proteins

    • Perform expression in the presence of zinc chelators if appropriate

  • Loss of activity during storage:

    • Store in 50% glycerol at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Keep working aliquots at 4°C for up to one week

    • Consider lyophilization in the presence of stabilizing excipients

  • DNA contamination:

    • Treat with nucleases that can be inhibited by reducing agents

    • Use polyethyleneimine precipitation to remove nucleic acids

    • Apply stringent washing during affinity purification

What factors influence the catalytic activity of recombinant HtpX and how can they be optimized?

Multiple factors influence HtpX catalytic activity, which researchers can optimize:

  • Zinc availability:

    • HtpX is zinc-dependent; ensure appropriate zinc concentrations (typically 10-100 μM ZnCl₂)

    • Avoid excessive zinc which can cause protein aggregation

    • Consider zinc buffering systems for precise control

  • Detergent selection:

    • Use mild detergents (DDM, CHAPS) at concentrations above CMC but not excessively high

    • Test multiple detergents to identify optimal conditions

    • Consider reconstitution in nanodiscs or liposomes for more native-like environment

  • pH optimization:

    • M48 metalloproteases typically show optimal activity at neutral to slightly alkaline pH

    • Test pH range 6.5-8.5 to determine optimum

    • Consider pH gradient effects across membranes for in vivo activity

  • Temperature effects:

    • For A. salmonicida HtpX, consider its psychrophilic origin

    • Test activity at lower temperatures (4-25°C) compared to mesophilic homologs

    • Evaluate temperature stability profiles to establish optimal assay conditions

  • Substrate presentation:

    • Ensure proper substrate folding/membrane integration

    • Consider substrate concentration effects on activity

    • Test various substrate:enzyme ratios (typically 10:1 to 100:1)

  • Reducing environment:

    • Test activity with/without reducing agents (DTT, β-mercaptoethanol)

    • Evaluate the impact of oxidation on activity

    • Consider the native redox environment of the bacterial periplasm/membrane

By systematically optimizing these parameters, researchers can establish robust activity assays for recombinant HtpX and better characterize its enzymatic properties.

What structural studies could advance our understanding of HtpX function?

Several structural approaches could significantly advance our understanding of HtpX:

  • X-ray crystallography challenges and solutions:

    • Membrane protein crystallization remains challenging

    • Consider truncated constructs focusing on the catalytic domain

    • Use fusion partners specifically designed for crystallization (T4 lysozyme insertions)

    • Apply lipidic cubic phase methods for membrane protein crystallization

  • Cryo-electron microscopy opportunities:

    • Single-particle cryo-EM for membrane proteins has advanced significantly

    • Consider nanodiscs or amphipols to maintain native-like environment

    • Focus on HtpX in complex with substrate proteins to capture functional states

  • NMR spectroscopy approaches:

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-embedded regions

    • Use selective isotopic labeling to focus on catalytic residues

  • Molecular dynamics simulations:

    • Model substrate access channels within the membrane

    • Simulate zinc coordination and catalytic mechanism

    • Predict conformational changes during substrate binding and processing

  • Cross-linking mass spectrometry:

    • Identify substrate binding interfaces

    • Map interactions with other components of the quality control machinery

    • Characterize conformational dynamics during catalysis

These structural studies would provide crucial insights into how HtpX recognizes and processes membrane protein substrates, potentially enabling structure-based design of inhibitors or engineered variants with enhanced properties.

How might HtpX research inform strategies for enhancing recombinant protein production?

Research on HtpX and related proteases offers several strategies to improve recombinant protein production:

  • Proteolytic stress management:

    • Co-express chaperones to reduce misfolding and subsequent degradation

    • Engineer expression hosts with modified membrane proteases (htpX, ftsH) to minimize unwanted degradation

    • Design constructs resistant to specific proteolytic cleavage

  • Fusion tag development:

    • Hero protein fusions have shown promise for enhancing protein stability

    • Rationally design fusion tags based on HtpX substrate specificity to avoid cleavage

    • Develop novel tags that specifically protect against membrane proteases

  • Host strain engineering:

    • Create expression hosts with modified membrane proteolytic networks

    • Develop conditional htpX knockdown/knockout strains for producing vulnerable proteins

    • Engineer feedback-regulated protease expression systems

  • Process optimization:

    • Implement optimized temperature shifts based on understanding of temperature-dependent HtpX activity

    • Develop bioreactor monitoring strategies for proteolytic stress indicators

    • Design feeding strategies to minimize proteolytic stress during high-density cultivation

  • Quality by design approaches:

    • Incorporate knowledge of proteolytic stress responses into process design

    • Develop predictive models for protein stability based on protease recognition features

    • Implement real-time monitoring of protein quality attributes affected by proteolysis

By applying insights from HtpX research, bioprocess engineers can develop more robust expression systems, particularly for challenging membrane proteins and proteins susceptible to proteolytic degradation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.