Recombinant Aliivibrio salmonicida UPF0208 membrane protein VSAL_I2111 (VSAL_I2111)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your consideration.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion in the manufacturing process.
Synonyms
VSAL_I2111; UPF0208 membrane protein VSAL_I2111
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Target Names
VSAL_I2111
Target Protein Sequence
MSDNGFLFRFKDGQTYMDTWPERKELAPMFPEQRVIKATKFAVKVMPAVAVISVLTQMVF NNSAALPQSIIIALFAISMPLQGFWWLGNRANTKLPPALVNWYRELYQKIIESGAALEPL KQRPRYKDLANILNKAFKQLDKTALERWF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does VSAL_I2111 relate to similar proteins in other bacteria?

VSAL_I2111 belongs to the UPF0208 membrane protein family, which includes similar proteins found in other bacterial species. A notable comparable protein is YfbV from Escherichia coli, for which computational structure models have been generated using AlphaFold . Comparative analysis reveals:

FeatureVSAL_I2111 (A. salmonicida)YfbV (E. coli)
Length149 amino acids151 amino acids
LocalizationMembrane proteinMembrane protein
FamilyUPF0208UPF0208
StructureNot experimentally determinedComputed model available (pLDDT score: 83.1)
OrganismPsychrophilic fish pathogenMesophilic intestinal bacterium

Understanding the structural and functional similarities between VSAL_I2111 and YfbV may provide insights into conserved roles of UPF0208 family proteins across different bacterial species. The availability of computational models for YfbV offers a potential template for modeling the structure of VSAL_I2111 .

What expression systems are suitable for recombinant production of VSAL_I2111?

E. coli expression systems have been successfully employed for the recombinant production of VSAL_I2111. The recombinant protein has been produced with an N-terminal His-tag for purification purposes . For membrane proteins like VSAL_I2111, several considerations should guide the choice of expression system:

What purification strategies are most effective for recombinant VSAL_I2111?

Purification of recombinant VSAL_I2111 requires specialized approaches due to its membrane protein nature. The following methodological workflow is recommended:

  • Cell lysis optimization:

    • Mechanical disruption (sonication, French press) or chemical lysis (detergents)

    • Buffer composition typically includes 20-50 mM Tris or phosphate buffer (pH 7.5-8.0)

    • Addition of protease inhibitors to prevent degradation

  • Membrane fraction isolation:

    • Differential centrifugation to separate membrane fractions

    • Low-speed centrifugation (5,000-10,000g) to remove cell debris

    • Ultracentrifugation (100,000g) to collect membrane fractions

  • Detergent solubilization:

    • Screening of detergents (DDM, LDAO, Triton X-100) for optimal solubilization

    • Typical concentrations range from 0.5-2% for initial solubilization

    • Reduction to 0.05-0.1% detergent in purification buffers

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

    • Ni-NTA or Co-NTA resins with imidazole gradients for elution

    • Typical elution requires 250-500 mM imidazole

  • Further purification:

    • Size exclusion chromatography for removing aggregates and ensuring homogeneity

    • Ion exchange chromatography as an optional additional step

  • Storage considerations:

    • Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been used successfully

    • Addition of glycerol (final concentration 5-50%) for long-term storage

    • Storage at -20°C/-80°C with avoidance of repeated freeze-thaw cycles

How can researchers address toxicity issues when expressing VSAL_I2111?

Expression of membrane proteins from A. salmonicida, including potentially VSAL_I2111, can present toxicity challenges in E. coli expression systems. Drawing from experiences with other A. salmonicida proteins, researchers can employ several strategies to overcome toxicity issues:

  • Fusion to solubility tags: Large solubility tags such as maltose-binding protein (MBP) or Glutathione-S-transferase (GST) have been successfully used to reduce toxicity of A. salmonicida proteins in E. coli .

  • Tight expression control:

    • Use of tightly regulated promoters (T7lac, araBAD)

    • Lower incubation temperatures (16-20°C) during induction

    • Reduced inducer concentrations

    • Shorter induction periods

  • Specialized E. coli strains:

    • C41(DE3) and C43(DE3) strains designed for toxic membrane proteins

    • BL21(DE3)pLysS to reduce leaky expression

    • Lemo21(DE3) for tunable expression levels

  • Codon optimization:

    • Adaptation of the coding sequence to E. coli codon usage

    • Removal of rare codons that might cause translational pausing

  • Expression as truncated constructs:

    • Domain-based expression instead of full-length protein

    • Removal of highly hydrophobic regions that may cause toxicity

These approaches have been successfully applied to other A. salmonicida proteins, such as its ATP-dependent DNA ligase, which exhibited moderate toxicity to E. coli cells .

What analytical techniques are most informative for characterizing VSAL_I2111?

Comprehensive characterization of VSAL_I2111 requires a multi-technique approach to assess its structural, functional, and biochemical properties:

  • Protein quality assessment:

    • SDS-PAGE for purity evaluation (>90% purity achieved in recombinant preparations)

    • Western blotting for specific detection using anti-His antibodies

    • Mass spectrometry for accurate molecular weight determination and post-translational modifications

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Fourier-transform infrared spectroscopy (FTIR) for membrane protein structure

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for structural determination without crystallization

    • Nuclear magnetic resonance (NMR) for dynamics studies

  • Functional analysis:

    • Membrane reconstitution assays in liposomes or nanodiscs

    • Protein-protein interaction studies (pull-down assays, co-immunoprecipitation)

    • Electrophysiology if channel or transporter function is suspected

    • Binding assays for potential ligands

  • Computational analysis:

    • Homology modeling based on related structures like YfbV from E. coli

    • Molecular dynamics simulations to study membrane interactions

    • Bioinformatic analysis for functional prediction

Each technique provides complementary information, and the integration of multiple approaches yields the most comprehensive characterization of membrane proteins like VSAL_I2111.

How might VSAL_I2111 contribute to Aliivibrio salmonicida pathogenicity?

While direct evidence for VSAL_I2111's role in pathogenicity is limited, we can draw insights from research on other A. salmonicida virulence factors:

  • Potential roles in pathogenicity:

    • Membrane proteins often mediate host-pathogen interactions

    • Possible involvement in adhesion to host tissues

    • Potential role in immune evasion mechanisms

    • Contribution to membrane integrity under host environmental conditions

  • Comparative analysis with known virulence factors:
    A. salmonicida pathogenicity involves multiple factors, including chitinolytic enzymes like lytic polysaccharide monooxygenases (LPMOs). These enzymes contribute significantly to virulence, particularly in the invasive phase of cold-water vibriosis . Similar to these characterized virulence factors, VSAL_I2111 might:

    • Function in adaptation to host environments

    • Contribute to invasion processes

    • Participate in proteome reorganization in response to host immune components

  • Experimental approaches to investigate pathogenicity roles:

    • Gene knockout studies and virulence assessment in infection models

    • Transcriptomic analysis to determine expression patterns during infection

    • Protein localization during host-pathogen interaction

    • Assessment of immune responses to purified VSAL_I2111

Understanding how VSAL_I2111 might contribute to pathogenicity could provide valuable insights into cold-water vibriosis pathogenesis and potentially identify new therapeutic targets.

What mutagenesis approaches can elucidate VSAL_I2111 structure-function relationships?

Site-directed mutagenesis offers powerful tools for investigating structure-function relationships in VSAL_I2111. A systematic approach would include:

  • Target residue identification:

    • Conserved residues across UPF0208 family members

    • Charged residues in transmembrane regions (unusual and often functionally important)

    • Potential ligand-binding sites based on structural predictions

    • Residues at predicted protein-protein interaction interfaces

  • Mutagenesis strategies:

    • Alanine scanning of conserved regions

    • Conservative vs. non-conservative substitutions

    • Domain swapping with homologous proteins

    • Truncation constructs to identify functional domains

  • Functional characterization of mutants:

    • Expression and stability assessment

    • Localization studies in bacterial cells

    • Oligomerization state determination

    • Functional assays once putative functions are identified

  • In vivo significance testing:

    • Complementation studies in knockout strains

    • Virulence assessment in animal models

    • Host cell interaction analysis

Similar approaches have been successfully employed to study other A. salmonicida virulence factors, such as the LPMOs AsLPMO10A and AsLPMO10B, where isogenic deletion mutants revealed roles in the invasive phase of cold-water vibriosis .

How do environmental conditions affect VSAL_I2111 expression and function?

A. salmonicida is a psychrophilic bacterium that causes cold-water vibriosis, suggesting adaptation to low-temperature environments. Understanding how environmental conditions affect VSAL_I2111 expression and function requires:

  • Temperature-dependent studies:

    • Expression analysis across temperature ranges (4°C to 20°C)

    • Stability and activity assays at different temperatures

    • Structural changes using temperature-controlled CD spectroscopy

  • Host-mimicking conditions:

    • Expression in the presence of fish serum components

    • Response to antimicrobial peptides

    • Adaptation to salt concentrations mimicking fish tissues

  • Growth phase dependency:

    • Transcriptomic and proteomic analysis across bacterial growth phases

    • Correlation with virulence expression patterns

  • Experimental design considerations:

    • Use of appropriate temperature controls

    • Standardization of growth conditions

    • Integration of in vitro and in vivo approaches

Research on other A. salmonicida proteins has shown that exposure to Atlantic salmon serum results in substantial proteome reorganization , suggesting environmental responsiveness that might also apply to VSAL_I2111 expression and function.

What are the main challenges in studying membrane proteins like VSAL_I2111?

Membrane proteins present unique challenges that require specialized approaches:

  • Expression and purification challenges:

    • Low expression levels compared to soluble proteins

    • Toxicity to expression hosts as observed with other A. salmonicida proteins

    • Difficulty maintaining native conformation during extraction

    • Detergent selection criticality for solubilization

  • Structural analysis limitations:

    • Resistance to crystallization for X-ray studies

    • Size limitations for NMR analysis

    • Detergent micelle interference with structure determination

  • Functional characterization barriers:

    • Need for membrane reconstitution to study native function

    • Complex lipid environment requirements

    • Difficulty in developing specific functional assays

  • Solutions and alternative approaches:

    • Fusion partners to enhance expression and stability

    • Nanodiscs or liposomes for membrane reconstitution

    • Cryo-EM for structure determination without crystallization

    • Computational predictions based on homologous proteins like YfbV

These challenges necessitate integrated experimental approaches and often require method optimization specific to each membrane protein.

How can researchers interpret conflicting data about VSAL_I2111?

When faced with conflicting data about VSAL_I2111, researchers should employ a systematic approach to interpretation:

Advanced research methods, such as those outlined in comprehensive methodological resources, provide frameworks for addressing data conflicts in psychological and biological research .

What promising research avenues exist for VSAL_I2111 and cold-water vibriosis?

Future research on VSAL_I2111 should explore several promising avenues:

  • Integrated structural and functional studies:

    • Cryo-EM or X-ray crystallography structural determination

    • Structure-guided functional assays

    • Computational simulations of membrane interactions

  • Role in pathogenesis:

    • Gene knockout studies in infection models

    • Transcriptional regulation during different infection stages

    • Interaction with host immune components

  • Comparative studies:

    • Functional comparison with homologs in other Vibrio species

    • Evolutionary analysis across marine bacterial pathogens

    • Structural comparison with the E. coli YfbV protein

  • Therapeutic targeting potential:

    • Epitope mapping for potential vaccine development

    • Small molecule inhibitor screening

    • Antibody development for neutralization studies

  • Multi-omics integration:

    • Correlation of proteomics, transcriptomics, and metabolomics data

    • Network analysis to position VSAL_I2111 in pathogen virulence networks

    • Host-pathogen interaction maps

These research directions would complement existing work on A. salmonicida virulence factors, such as the ATP-dependent DNA ligase and chitinolytic enzymes , contributing to a more comprehensive understanding of cold-water vibriosis pathogenesis.

How might recombinant protein technology advance VSAL_I2111 research?

Recombinant protein technology offers powerful tools for advancing VSAL_I2111 research:

  • Advanced expression strategies:

    • Cell-free expression systems for toxic proteins

    • Insect cell or mammalian cell expression for complex membrane proteins

    • Directed evolution for improved expression and stability

  • Innovative tagging approaches:

    • Split-GFP systems for membrane protein localization

    • SNAP/CLIP tags for dynamic imaging studies

    • Proximity labeling tags for interaction partner identification

  • Structural biology advancements:

    • Antibody fragment co-crystallization to facilitate structure determination

    • Novel membrane mimetics (nanodiscs, amphipols, SMALPs)

    • Integration of hydrogen-deuterium exchange mass spectrometry with other structural techniques

  • High-throughput methodologies:

    • Automated purification and characterization pipelines

    • Parallel screening of expression and purification conditions

    • Microfluidic approaches for functional studies

These technological approaches could overcome current limitations in studying membrane proteins from psychrophilic organisms like A. salmonicida, potentially leading to breakthrough discoveries about VSAL_I2111's function and role in pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.