Recombinant Alkalilimnicola ehrlichei ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The ATP synthase subunit a (atpB) is encoded by the atpB gene (locus: Mlg_2875) in A. ehrlichii MLHE-1 . It forms part of the membrane-embedded F₀ sector, facilitating proton translocation across the membrane to drive ATP synthesis . Key features include:

  • Molecular Function: Proton channeling and coupling proton motive force to ATP synthesis .

  • Structural Role: Interaction with the c-ring of F₀ and peripheral stalk subunits to maintain complex stability .

Recombinant Production

Recombinant atpB is produced using heterologous expression systems. Specifications vary by vendor but generally include:

ParameterDetails
Expression SystemE. coli, Yeast, Baculovirus, or Mammalian cells
Purity>85% (SDS-PAGE)
TagDetermined during production (e.g., His-tag, Avi-tag)
Storage-20°C/-80°C (lyophilized or liquid); reconstitute in Tris-based buffer
Reconstitution0.1–1.0 mg/mL in sterile water, with 50% glycerol recommended

Functional and Research Applications

Recombinant atpB is utilized in:

  • Enzyme Mechanism Studies: Probing proton transport and ATP synthase regulation .

  • Antibody Development: As an immunogen for anti-ATP synthase antibodies .

  • Structural Biology: Cryo-EM and X-ray crystallography to resolve F₀ sector architecture .

Vendor-Specific Data

Commercial variants include:

Product CodeSourceConjugateAvailability
CSB-EP600740AAAL1E. coliNone50 µg–1 mg
CSB-EP600740AAAL1-BE. coliAvi-tag BiotinylatedInquire
CSB-BP600740AAAL1BaculovirusNoneInquire

Research Challenges and Insights

  • Thermostability: Retains activity at pH 7.3–10.0 and salinity up to 190 g/L, reflecting its haloalkaliphilic origin .

  • Inhibitor Targets: Unique αCTD and γ-loop regions in homologs suggest species-specific drug targeting opportunities .

Future Directions

Ongoing research aims to:

  • Elucidate proton translocation mechanisms under extreme pH/salinity .

  • Engineer thermostable variants for industrial ATP synthesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This serves as a reference for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Mlg_2875; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Target Names
atpB
Target Protein Sequence
MSGNTALDYIQHHLTNLAVGEGYWTFHVDSLIMSFSLGALFCYLFWLGARRATAGVPSGL QNFVELMVEFVDQTTRETFQGKSRLIAPLALTIFCWIFLMNLMDLVPIDMVPSLMYAAGV DYFKILPTVDLNVTFALSISVFFLIIAYSFKGKGAGGFAKELLFHPFGPWLLPFNLILNI IELIAKPISLSLRLFGNMYAAELIFILISLLPWWIQWALGTPWAIFHILVIPLQAFIFMM LTVVYLSMANEHEEH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a in Alkalilimnicola ehrlichei?

ATP synthase subunit a (atpB) in Alkalilimnicola ehrlichei is a critical component of the F0 sector of the ATP synthase complex. This membrane-embedded protein forms part of the proton channel that enables proton translocation across the membrane, driving ATP synthesis. The a-subunit works in concert with the c-ring to create the rotary mechanism essential for energy conversion. In Alkalilimnicola ehrlichei, this protein has been identified as a transmembrane component crucial for the enzyme's function in this extremophilic bacterium .

How does the a-subunit contribute to ATP synthesis mechanism?

The a-subunit forms a crucial part of the proton pathway in the ATP synthase complex. It contains essential residues that facilitate proton movement across the membrane, which drives the rotation of the c-ring. This rotation is mechanically coupled to conformational changes in the F1 sector, leading to ATP synthesis. Specifically, the a-subunit contains conserved charged residues, including an essential arginine (equivalent to Arg-210 in Escherichia coli), which prevents proton short-circuiting and ensures unidirectional proton flow through the complex .

What is the molecular weight and basic characteristics of recombinant Alkalilimnicola ehrlichei atpB?

The recombinant Alkalilimnicola ehrlichei ATP synthase subunit a is available as a partial protein with purity >85% as determined by SDS-PAGE. While the exact molecular weight is not specified in the available data, ATP synthase a-subunits typically range from 25-30 kDa. The protein is assigned the UniProt identification number Q0A4M2 and is commonly expressed in E. coli expression systems for research purposes .

What are the optimal storage conditions for maintaining recombinant atpB stability?

For optimal stability, recombinant Alkalilimnicola ehrlichei ATP synthase subunit a should be stored at -20°C/-80°C. The shelf life varies based on formulation: liquid preparations typically remain stable for approximately 6 months, while lyophilized forms can maintain stability for up to 12 months. To prevent protein degradation, repeated freeze-thaw cycles should be strictly avoided. For short-term usage, working aliquots can be stored at 4°C for up to one week, but longer periods may compromise protein integrity .

What is the recommended protocol for reconstitution of lyophilized atpB protein?

For optimal reconstitution of lyophilized Alkalilimnicola ehrlichei ATP synthase subunit a, the vial should first be briefly centrifuged to ensure all contents are at the bottom. The protein should then be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. For long-term storage of the reconstituted protein, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard practice) and prepare aliquots to minimize freeze-thaw cycles. The aliquots should then be stored at -20°C/-80°C for maximum stability .

How can researchers verify the functional integrity of the recombinant atpB after reconstitution?

After reconstitution, researchers can verify the functional integrity of recombinant atpB through several approaches:

  • ATPase activity assays: Similar to studies with other ATP synthase components, octylglucoside-stimulated ATPase activity can be measured to assess functionality.

  • Structural analysis: Circular dichroism (CD) spectroscopy can confirm proper protein folding.

  • Binding assays: Assessing the protein's ability to interact with other ATP synthase components.

  • Reconstitution into liposomes: Testing proton translocation capabilities in an artificial membrane system.

These approaches provide complementary information about different aspects of the protein's structural and functional integrity .

What analytical techniques are most effective for studying the structure-function relationship of atpB?

Several analytical techniques provide valuable insights into the structure-function relationship of ATP synthase subunit a:

  • Cryo-electron microscopy (cryo-EM): Enables visualization of the protein's structure within the ATP synthase complex, revealing interactions with other subunits and bound lipids.

  • Site-directed mutagenesis: Allows investigation of specific residues' roles in proton translocation and subunit interactions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies dynamic regions and solvent-accessible areas of the protein.

  • Cross-linking studies: Reveals spatial relationships between atpB and neighboring subunits.

  • Molecular dynamics simulations: Provides insights into conformational changes during proton transport.

These complementary approaches have been successfully applied to ATP synthase a-subunits from various organisms and could be adapted for studying Alkalilimnicola ehrlichei atpB .

How can researchers distinguish between recombinant atpB and native protein in experimental systems?

Distinguishing recombinant atpB from native protein can be accomplished through several approaches:

  • Tag detection: If the recombinant protein contains an affinity tag (as indicated in the product specifications that tag type is determined during manufacturing), antibodies specific to the tag can be used.

  • Mass spectrometry: Can detect subtle differences in mass between recombinant and native proteins.

  • Species-specific antibodies: Development of antibodies that recognize unique epitopes in Alkalilimnicola ehrlichei atpB.

  • Sequence verification: Targeted peptide mapping can identify sequence differences.

A combination of these methods provides the most reliable differentiation between recombinant and native proteins in experimental systems .

How does Alkalilimnicola ehrlichei ATP synthase a-subunit compare to those from other extremophiles?

While specific comparative data for Alkalilimnicola ehrlichei ATP synthase a-subunit is limited, studies of ATP synthases from other extremophiles provide valuable context. Alkaliphilic bacteria, such as Bacillus pseudofirmus OF4, possess distinctive features in their a-subunits that enable ATP synthesis under extreme pH conditions. For instance, the a-subunit from B. pseudofirmus OF4 contains a lysine residue (Lys-180) in the proton uptake pathway that is uniquely found in alkaliphiles, suggesting adaptation to alkaline environments .

Comparatively, thermoalkaliphiles like Caldalkalibacillus thermarum TA2.A1 show differences in their a-subunit structure that reflect adaptation to both high pH and high temperature. The specific adaptations in Alkalilimnicola ehrlichei atpB would likely reflect its ecological niche as a haloalkaliphilic bacterium, potentially showing molecular features that facilitate function in high salt and high pH environments .

What insights can be gained from comparing atpB sequences across different bacterial species?

Sequence alignments of ATP synthase a-subunits across bacterial species reveal evolutionarily conserved regions essential for function as well as species-specific adaptations. Key insights include:

  • Conserved proton channel residues: Critical charged residues in the proton pathway, such as the equivalent of Arg-210 in E. coli, are typically conserved across species.

  • Species-specific adaptations: Residues that vary between species often reflect adaptations to specific environmental conditions.

  • Structural determinants: Sequence variations in transmembrane helices can influence proton affinity, selectivity, and translocation rates.

  • Evolutionary relationships: Phylogenetic analysis based on atpB sequences can provide insights into the evolutionary history of ATP synthases.

For Alkalilimnicola ehrlichei, comparative sequence analysis could reveal adaptations specific to its unique environmental niche compared to other extremophiles and mesophilic organisms .

What are the best expression systems for producing functional recombinant Alkalilimnicola ehrlichei atpB?

E. coli expression systems are commonly used for producing recombinant Alkalilimnicola ehrlichei ATP synthase subunit a, as indicated in the product information . For optimal expression of functional protein, researchers should consider:

  • Expression strain selection: BL21(DE3) or C41(DE3)/C43(DE3) strains are often preferred for membrane proteins.

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations may improve proper folding.

  • Membrane targeting: Including native signal sequences or fusion partners to ensure proper membrane insertion.

  • Detergent screening: Identifying optimal detergents for extraction and purification while maintaining function.

  • Codon optimization: Adjusting codons to match E. coli preference while preserving critical structural elements.

These considerations can significantly improve yields of functional recombinant atpB protein for experimental applications .

How can researchers effectively incorporate recombinant atpB into proteoliposomes for functional studies?

Incorporating recombinant atpB into proteoliposomes for functional studies requires a systematic approach:

  • Lipid composition selection: A mixture of phospholipids (typically including phosphatidylcholine, phosphatidylethanolamine, and cardiolipin) that mimics the native membrane environment.

  • Reconstitution method: Detergent-mediated reconstitution using controlled detergent removal through dialysis, Bio-Beads, or gel filtration.

  • Protein-to-lipid ratio optimization: Typically testing ratios between 1:50 and 1:200 (w/w).

  • Orientation control: Methods such as pH gradients or freeze-thaw cycles to influence protein orientation in the membrane.

  • Functional verification: Measuring proton translocation using pH-sensitive dyes or electrodes.

This approach enables the study of atpB function in a controlled membrane environment that mimics its native conditions .

How can site-directed mutagenesis of atpB advance our understanding of proton translocation mechanisms?

Site-directed mutagenesis of atpB can provide crucial insights into the proton translocation mechanism of ATP synthase. Drawing from studies on related organisms, researchers can:

  • Target conserved charged residues: Replacing key residues such as conserved arginines equivalent to Arg-210 in E. coli can reveal their role in preventing proton short-circuiting.

  • Investigate pH-dependent residues: Mutations of residues potentially involved in adaptation to extreme pH, similar to Lys-180 in alkaliphilic Bacillus species.

  • Modify transmembrane helices: Alterations in the hydrophobicity or charge distribution of transmembrane segments can reveal their contribution to proton channel formation.

  • Create chimeric proteins: Swapping segments between atpB from different species can identify domain-specific contributions to function.

Such mutational studies, combined with functional assays, can map the proton pathway and elucidate the molecular mechanism of proton translocation in Alkalilimnicola ehrlichei ATP synthase .

What role does the a-subunit play in ATP synthase dimerization and membrane curvature?

ATP synthase complexes from various organisms form dimers and higher-order oligomers that contribute to membrane curvature, particularly in mitochondria and some bacteria. Studies suggest that:

  • Dimer interface: The a-subunit often contributes to the dimer interface, along with other membrane subunits like subunit g.

  • Membrane bending: The specific angle between monomers in the dimer, influenced by the a-subunit structure, affects the degree of membrane curvature.

  • Lipid interactions: The a-subunit interacts with specific lipids, particularly cardiolipins, which may stabilize the dimer interface.

  • Species-specific differences: Different organisms exhibit varying dimer architectures and interface areas, ranging from 3,600 Ų to 16,000 Ų.

In Trypanosoma brucei, for example, the dimerization interface is smaller (3,600 Ų) compared to Euglena gracilis (10,000 Ų) and Tetrahymena thermophila (16,000 Ų), with specific subunits and lipids mediating the interaction .

How do specific lipid interactions influence atpB function in ATP synthase?

Lipid interactions play crucial roles in ATP synthase function, particularly for the membrane-embedded a-subunit:

  • Cardiolipin binding: In some ATP synthases, cardiolipins bind at specific sites on the a-subunit, stabilizing its structure and potentially facilitating proton movement.

  • Lipid-protein interface: In Trypanosoma brucei ATP synthase, a phosphatidylcholine molecule occupies a position that in other organisms is filled by a protein element (bH2), suggesting lipids can functionally replace protein elements in the proton path.

  • Membrane fluidity effects: The lipid environment affects a-subunit flexibility and conformational changes necessary for function.

  • Dimerization mediation: Specific lipids, particularly cardiolipins, are observed at the dimer interface, suggesting they contribute to higher-order ATP synthase organization.

These lipid-protein interactions represent an emerging area of research that could provide insights into Alkalilimnicola ehrlichei atpB function in its native membrane environment .

What strategies can overcome common challenges in recombinant atpB expression and purification?

Researchers working with recombinant Alkalilimnicola ehrlichei ATP synthase subunit a may encounter several challenges. Effective troubleshooting strategies include:

ChallengePotential Solutions
Low expression yield- Optimize codon usage for expression host
- Test different promoter systems
- Reduce expression temperature to 16-20°C
- Use specialized E. coli strains (C41/C43) designed for membrane proteins
Protein misfolding/aggregation- Include molecular chaperones as co-expression partners
- Add stabilizing agents during expression (glycerol, specific ions)
- Express as fusion with solubility-enhancing partners
- Screen various detergents for stabilization
Difficult membrane extraction- Optimize detergent type and concentration
- Use detergent mixtures for efficient solubilization
- Consider native nanodiscs or amphipols for stabilization
- Implement gentle extraction procedures with gradual detergent addition
Protein instability after purification- Add stabilizing lipids during purification
- Maintain glycerol (5-10%) in all buffers
- Keep samples at 4°C during handling
- Add protease inhibitors throughout purification

Implementing these strategies can significantly improve the quantity and quality of purified recombinant atpB protein .

How can researchers differentiate between functional and non-functional forms of recombinant atpB?

Distinguishing between functional and non-functional forms of recombinant atpB requires multiple complementary approaches:

  • ATPase activity assays: Although the a-subunit itself doesn't have catalytic activity, its incorporation into the ATP synthase complex should support ATP hydrolysis/synthesis. Similar to studies with other ATP synthases, octylglucoside-stimulated ATPase activity can be a useful indicator.

  • Proton translocation assays: After reconstitution into liposomes, measure proton pumping activity using pH-sensitive fluorescent dyes (ACMA, pyranine) or pH electrodes.

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to identify properly folded regions

  • Binding assays: Verify interaction with other ATP synthase subunits (particularly c-ring components) using pull-down assays or surface plasmon resonance.

These assays can collectively provide a comprehensive assessment of atpB functionality .

What are the emerging techniques for studying atpB structure-function relationships in situ?

Several cutting-edge techniques are transforming our ability to study ATP synthase a-subunit structure-function relationships in near-native conditions:

  • Cryo-electron tomography (cryo-ET): Enables visualization of ATP synthase in its cellular context, revealing native organization and membrane interactions.

  • Single-molecule FRET: Allows detection of conformational changes during the catalytic cycle, providing insights into dynamic aspects of atpB function.

  • In-cell NMR spectroscopy: Provides atomic-level structural information on the protein within living cells.

  • Native mass spectrometry: Preserves protein-protein and protein-lipid interactions, allowing characterization of the intact complex.

  • Genome editing combined with high-resolution imaging: CRISPR-Cas9 modification of atpB followed by super-resolution microscopy can reveal its organization and dynamics in vivo.

These emerging techniques offer unprecedented insights into how atpB functions within the complete ATP synthase complex and in its native membrane environment .

How does the a-subunit contribute to ATP synthase adaptation in extremophiles like Alkalilimnicola ehrlichei?

The a-subunit plays a critical role in ATP synthase adaptation to extreme environments. In extremophiles like Alkalilimnicola ehrlichei, several adaptation mechanisms may be present:

  • pH adaptation: In alkaliphiles like Bacillus pseudofirmus OF4, the a-subunit contains specific residues (e.g., Lys-180) that facilitate proton capture and retention under alkaline conditions. Similar adaptations may exist in Alkalilimnicola ehrlichei, which also thrives in alkaline environments.

  • Salt tolerance: As a haloalkaliphile, Alkalilimnicola ehrlichei likely possesses adaptations in the a-subunit that maintain function in high-salt conditions, potentially including increased acidic residue content on the protein surface and specific ion-binding sites.

  • Proton-binding residues: The positioning and pKa values of key residues in the proton pathway may be optimized for function under extreme conditions.

  • Structural rigidity/flexibility balance: Modified transmembrane helix interactions may provide the optimal balance between structural stability and necessary flexibility for function in extreme environments.

Studies of ATP synthase a-subunits from other extremophiles suggest that even single amino acid changes can dramatically affect the enzyme's ability to function under extreme conditions, highlighting the importance of these adaptations .

What technological advances are needed to better understand atpB function in energy conversion?

Future advances in several areas could significantly enhance our understanding of ATP synthase a-subunit function:

  • Time-resolved structural techniques: Methods that capture transient conformational states during proton translocation would provide critical insights into the dynamic aspects of atpB function.

  • Computational approaches: Advanced molecular dynamics simulations incorporating quantum mechanics could model proton movement through the a-subunit with greater accuracy.

  • High-throughput mutagenesis platforms: Systems for rapid generation and testing of multiple a-subunit variants would accelerate functional mapping of the protein.

  • Improved membrane mimetics: Development of better membrane models that more accurately reflect the native lipid environment of Alkalilimnicola ehrlichei.

  • Single-enzyme measurements: Technologies enabling activity measurements of individual ATP synthase complexes would reveal functional heterogeneity and rare states.

These technological developments would address current limitations in our understanding of the molecular mechanisms of proton translocation through the a-subunit .

How might research on Alkalilimnicola ehrlichei atpB contribute to bioenergetic applications?

Research on Alkalilimnicola ehrlichei ATP synthase subunit a has several potential applications in bioenergetics and biotechnology:

  • Biomimetic energy conversion: Understanding the proton translocation mechanism could inspire artificial ATP synthesis systems or novel approaches to energy conversion.

  • Extreme-condition biocatalysts: Insights into how this protein functions in alkaline, potentially high-salt environments could guide engineering of industrial enzymes for harsh conditions.

  • Membrane protein design principles: The structure-function relationships revealed could inform design of synthetic membrane proteins for various applications.

  • Antimicrobial targets: As ATP synthase is essential for many pathogens, understanding unique features of bacterial a-subunits could guide development of selective inhibitors.

  • Biohybrid technologies: Integration of ATP synthase components into synthetic materials could enable development of self-powered nano/microdevices.

The fundamental knowledge gained from studying this specialized ATP synthase component could thus have broad implications beyond basic science .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.