Recombinant Alkalilimnicola ehrlichei Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msbA; Mlg_2803; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Target Names
msbA
Target Protein Sequence
MSKGHSDHPSAGESWHLYKRIFGFIKPYWRLGVLAIVCMVLAAAGQAAFAWIIQPLVDGT FIEQDPGARLWVPATLVGIFLFHGVTTFASDYTVAWVGRRVVKDVRQAVFEQYLRLPTSY FDKNSPGTLLAKLTYNVNQISAAASKAVVVLVRDTFTVIFLLAYMTYLSGWLVMIVFGLG PLVAVVVTAANKRFRKLSRRMQASVGEYAQIAEDGIRGQAEVKIFGGQRYEAERFDRTNT RHHRQLMRYKAVQAASQPLAQLGAVIALAIILYLATMDVILETISPGGMISFIAAMLLML PPLKRVIGVNAEIQKALAAGESVFEVLDAPPEPDHGQRPLERARGLIEFDRVAFRYPESE DWVLRDINLSIQPGETVALVGRSGSGKTTLASLLPRFYDPQRGEIRLDGHPLAEYRLQAL RSQMSLVNQQVVLFNDSLANNIAYGLSERPTAAQLQAAARAANALEFIEELPEGFDTVIG ENGVMLSGGQRQRIAIARALLKDAPILILDEATSALDSESEKRIQEALEKLMRGRTTLVI AHRLSTIEDADRIVVLDAGRVVETGTHRELLDHNGHYASLHRVQFNGPS
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Alkalilimnicola ehrlichii and why is its MsbA protein significant in bacterial research?

Alkalilimnicola ehrlichii is a species of arsenite-oxidizing haloalkaliphilic gammaproteobacterium that was isolated from Mono Lake, an alkaline hypersaline soda lake in California, USA. It is a Gram-negative, motile, short-rod-shaped bacterium capable of both chemoautotrophic and heterotrophic growth . The bacterium can utilize various inorganic electron donors including arsenite, hydrogen, sulfide, or thiosulfate coupled with the reduction of nitrate to nitrite . The type strain is MLHE-1, which has been deposited in multiple culture collections (DSM 17681, ATCC BAA-1101) .

The MsbA protein from A. ehrlichii is significant in bacterial research because it represents an essential ATP-binding cassette transporter responsible for lipid A and lipopolysaccharide transport across the inner membrane. As a member of the ABC transporter family, A. ehrlichii MsbA provides insights into membrane transport mechanisms in extremophilic bacteria. Studying this protein from an extremophile may reveal unique adaptations that could inform our understanding of ABC transporters functioning under harsh environmental conditions, potentially offering novel perspectives on substrate recognition, binding, and transport mechanisms not observed in mesophilic bacteria.

How is the MsbA protein structurally organized?

The MsbA protein functions as a homodimer, with each subunit containing one transmembrane domain (TMD) and one nucleotide-binding domain (NBD) . The two TMDs form the lipopolysaccharide translocation pathway through the membrane, while the two NBDs are responsible for binding and hydrolyzing ATP to power the transport process . Structural studies have shown that MsbA can adopt different conformations including inward-facing (with TMDs open to the cytoplasm) and outward-facing (with TMDs open to the periplasm) orientations .

The transmembrane helices of MsbA create a cavity that accommodates the lipid A substrate, with specific residues involved in substrate recognition and binding. X-ray crystallography studies of MsbA have revealed that the protein can undergo dramatic conformational changes during its transport cycle, including significant separation of the NBDs in the inward-facing conformation that allows substrate entry . The structural flexibility of MsbA is essential for its function in transporting the bulky lipid A molecule across the membrane.

What is the physiological role of MsbA in gram-negative bacteria?

MsbA plays an essential role in the biogenesis of the outer membrane of gram-negative bacteria by facilitating the transport of newly synthesized lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This translocation step is critical because lipid A and LPS are synthesized on the cytoplasmic side but must be incorporated into the outer leaflet of the outer membrane to maintain cellular integrity.

The transport function of MsbA represents a crucial checkpoint in the LPS biosynthetic pathway. Without functional MsbA, lipid A and LPS accumulate in the inner leaflet of the cytoplasmic membrane, which is lethal to the bacterium. This essential function makes MsbA an attractive target for the development of novel antibacterial agents. In some bacteria, overexpression of MsbA can partially compensate for defects in other components of the LPS transport machinery, highlighting its central role in outer membrane biogenesis .

What does structural data reveal about MsbA's interaction with lipid A?

Structural studies of MsbA have provided significant insights into how the protein interacts with its lipid A substrate. Cryo-electron microscopy has revealed a robust palm-shaped density between the two TMDs that corresponds to bound LPS/lipid A . The strongest parts of this density correspond to the two glucosamines, each carrying one phosphate group (1-PO₄ and 4′-PO₄), and the inner core containing multiple phosphorylations . These negatively charged regions generate stronger electron scattering signals in structural analyses.

What conformational changes occur during MsbA's transport cycle?

MsbA undergoes significant conformational transitions during its transport cycle, which have been captured through various structural studies. These conformational changes can be grouped into three nucleotide states that correspond to different stages of the transport process :

  • ADP or nucleotide-free state: In this state, MsbA adopts an inward-facing conformation with TMDs open to allow LPS entry. Once LPS is bound, it restricts the TMD opening and aligns the NBDs for ATP binding.

  • ATP-bound state: ATP binding induces conformational changes that abolish LPS binding and facilitate the insertion of acyl chains into the periplasmic leaflet. The rearrangement of MsbA and LPS translocation occur as a concerted process, eventually leading to ATP hydrolysis.

  • ATP transition state: After LPS release, all transmembrane helices form a compact bundle. Upon release of the γ-phosphate following ATP hydrolysis, MsbA returns to the inward-facing conformation.

These conformational changes represent a complete transport cycle and are essential for understanding how MsbA functions as a lipid flippase. The crystal structure of MsbA from Salmonella typhimurium at 2.8 Å resolution shows an inward-facing conformation with a large amplitude opening in the transmembrane portal, which likely allows lipid A to enter the transport pathway from its site of synthesis .

How does the structure of MsbA facilitate ATP binding and hydrolysis?

The NBDs of MsbA contain several conserved motifs that are crucial for ATP binding and hydrolysis, including the Walker A and B motifs, the signature motif (C-loop), and the Q-loop. In the inward-facing conformation, the NBDs are separated, but upon substrate binding, they come closer together, allowing ATP to bind at the interface between them. Each ATP molecule is bound between the Walker A motif of one NBD and the signature motif of the opposite NBD, creating two ATP-binding sites in the functional dimer.

The hydrolysis of ATP triggers additional conformational changes that facilitate substrate translocation. The transition from the ATP-bound state to the ATP transition state involves the formation of a compact transmembrane helix bundle after LPS release . This structural arrangement is critical for completing the transport cycle and returning the transporter to its initial state. The coupling between ATP hydrolysis and substrate transport ensures that the energy from ATP is efficiently utilized to flip the lipid A molecule across the membrane.

What is the "trap-and-flip" model for MsbA-mediated LPS transport?

The "trap-and-flip" model for MsbA-mediated LPS transport describes a six-step process that explains how MsbA translocates LPS across the inner membrane . The model is supported by cryo-EM structures of MsbA in different conformational states:

  • MsbA in the inward-facing conformation opens its TMDs to allow LPS entry.

  • Stably bound LPS restricts TMDs opening and aligns NBDs for ATP binding.

  • Conformational changes abolish LPS binding.

  • Acyl chains of LPS enter the periplasmic leaflet as MsbA rearranges.

  • All TM helices form a compact bundle after LPS release.

  • Upon γ-phosphate release, MsbA returns to the inward-facing conformation.

This model differs from other proposed mechanisms for lipid translocation. Unlike the "credit card model" suggested for P4-ATPase flippases and TMEM16 scramblase, where the hydrophobic acyl chains remain in the membrane during flipping, the trap-and-flip model involves the complete enclosure of the lipid substrate within the protein during transport . The model also differs from the mechanism proposed for PglK, where only outward-facing conformations are relevant for substrate transport .

How do experimental structures support the transport mechanism?

Experimental structures of MsbA in different conformational states provide strong support for the proposed transport mechanism. Cryo-EM studies of MsbA reconstituted into lipid nanodiscs have revealed the structure of nucleotide-free MsbA with bound LPS at 4.2 Å resolution for the TMDs . This structure shows LPS binding deeply inside MsbA through extensive interactions, reaching the level of the target leaflet without flipping.

X-ray crystallography has also contributed to our understanding of MsbA conformations. A 2.8 Å resolution structure of MsbA from Salmonella typhimurium in an inward-facing conformation shows a large amplitude opening in the transmembrane portal, with putative lipid A density observed inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices . These structural observations are consistent with the trap-and-flip model.

Additional electron density attributed to lipid A has been observed near the periplasmic ends of the transmembrane helices, suggesting potential exit paths for the substrate after translocation . The collection of structures in different conformational states allows researchers to reconstruct the complete transport cycle, providing a comprehensive view of how MsbA facilitates lipid A flipping.

What residues are critical for substrate recognition and transport?

Structural studies have identified numerous residues within the transmembrane domains of MsbA that are involved in substrate recognition and transport. These include both hydrophilic residues that interact with the sugar and phosphate groups of lipid A and hydrophobic residues that accommodate the acyl chains. The binding site for LPS is characterized by positive charges that interact with the negatively charged phosphate groups on lipid A.

What expression systems and purification methods are optimal for recombinant A. ehrlichii MsbA?

For recombinant expression of A. ehrlichii MsbA, Escherichia coli expression systems are commonly employed. Given that MsbA is a membrane protein, expression constructs typically include affinity tags (such as polyhistidine tags) to facilitate purification. The selection of an appropriate detergent for solubilization is critical for maintaining protein stability and activity during purification. Commonly used detergents include n-dodecyl-β-D-maltopyranoside (DDM) and lauryl maltose neopentyl glycol (LMNG).

The purification protocol generally involves several steps:

  • Bacterial membrane isolation through differential centrifugation

  • Detergent solubilization of membrane proteins

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography to remove aggregates and achieve high purity

For structural studies, reconstitution into lipid nanodiscs can provide a more native-like membrane environment. This approach was successfully used to determine the cryo-EM structure of MsbA with bound LPS . Alternatively, facial amphiphiles can be used to stabilize the protein during crystallization, as demonstrated in the X-ray structure determination of MsbA from Salmonella typhimurium .

How can the transport activity of MsbA be measured in vitro?

Several methods have been developed to measure the transport activity of MsbA in vitro:

  • ATPase assays: The ATP hydrolysis activity of MsbA can be measured using colorimetric assays that detect the release of inorganic phosphate. This approach indirectly assesses transport function by measuring the energy consumption of the protein.

  • Fluorescence-based transport assays: Fluorescently labeled lipid A or analogues can be used to monitor transport across reconstituted proteoliposomes. By measuring fluorescence changes associated with substrate translocation, researchers can directly assess MsbA's flippase activity.

  • Conformational change monitoring: Techniques such as electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling can be used to track the conformational changes of MsbA during the transport cycle.

  • Binding assays: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can be used to measure the binding affinity of lipid A to MsbA and to determine how nucleotides affect this interaction.

These assays provide complementary information about different aspects of MsbA function and can be combined to obtain a comprehensive understanding of the transport mechanism.

What structural biology techniques have been most informative for studying MsbA?

Multiple structural biology techniques have contributed valuable insights into MsbA structure and function:

  • X-ray crystallography: This technique has provided high-resolution structures of MsbA in various conformational states. For example, a 2.8 Å resolution structure of MsbA from Salmonella typhimurium revealed an inward-facing conformation with putative lipid A density .

  • Cryo-electron microscopy (cryo-EM): Cryo-EM has been particularly valuable for visualizing MsbA with bound lipid A substrate. A study achieved 4.2 Å resolution for the TMDs of nucleotide-free MsbA reconstituted into lipid nanodiscs, clearly showing the bound LPS molecule .

  • Molecular dynamics simulations: Computational approaches have complemented experimental structures by modeling the dynamic behavior of MsbA during the transport cycle.

  • Site-directed spin labeling and EPR spectroscopy: These techniques have been used to track conformational changes in MsbA in response to lipid A binding and nucleotide hydrolysis.

Each technique provides unique information, and the combination of multiple approaches has been crucial for elucidating the complete picture of MsbA structure and function.

How does A. ehrlichii MsbA compare to MsbA from other gram-negative bacteria?

While specific comparative data between A. ehrlichii MsbA and MsbA from other bacteria is limited in the search results, general comparisons can be made based on available information. MsbA proteins from different gram-negative bacteria share the same basic architecture and function, with conservation of key structural elements including the transmembrane domains and nucleotide-binding domains.

The MsbA protein from Escherichia coli and Salmonella typhimurium have been studied extensively, providing reference points for comparing with A. ehrlichii MsbA. The crystal structure of MsbA from S. typhimurium at 2.8 Å resolution shows an inward-facing conformation with a large amplitude opening in the transmembrane portal . This structure is likely similar to the equivalent conformation of A. ehrlichii MsbA, though specific differences may exist due to the adaptation of A. ehrlichii to its extreme environment.

Given that A. ehrlichii is a haloalkaliphilic bacterium isolated from an alkaline hypersaline soda lake , its MsbA protein might exhibit adaptations to function optimally under high salt and high pH conditions. These adaptations could include differences in surface charge distribution, altered flexibility of certain domains, or modifications in substrate binding residues to accommodate potential variations in lipid A structure in this extremophile.

What insights from MsbA structure-function studies can be applied to human ABC transporters?

MsbA belongs to the ABC transporter superfamily, which includes numerous human transporters involved in various physiological processes and disease states. Several key insights from MsbA studies have broader implications for understanding human ABC transporters:

  • Conformational cycling: The alternating-access model demonstrated by MsbA, with transitions between inward-facing and outward-facing conformations, appears to be a general mechanism for ABC transporters . This understanding helps explain how human ABC transporters like P-glycoprotein (ABCB1) and cystic fibrosis transmembrane conductance regulator (CFTR) function.

  • Substrate recognition: The mechanisms by which MsbA recognizes and binds its lipid substrate provide insights into how human ABC transporters might recognize their respective substrates. Many human ABC transporters, including 20 of the 48 human ABC transporters, are involved in lipid or lipid-related compound transport .

  • Coupling ATP hydrolysis to transport: The structural basis for coupling ATP binding and hydrolysis to conformational changes that drive transport in MsbA likely has parallels in human ABC transporters.

  • Inhibitor binding sites: Structural studies of MsbA with bound inhibitors could inform the development of therapeutic agents targeting human ABC transporters involved in multidrug resistance in cancer and other diseases.

The structural and functional insights gained from studying bacterial ABC transporters like MsbA continue to enhance our understanding of their human counterparts, potentially contributing to the development of new therapeutic strategies for ABC transporter-related diseases.

How might A. ehrlichii MsbA serve as a model for studying extremophilic adaptations in membrane transporters?

As a protein from a haloalkaliphilic bacterium, A. ehrlichii MsbA offers a unique opportunity to study how membrane transporters adapt to extreme environmental conditions. Research could focus on:

  • Structural stability: Investigating how the protein maintains structural integrity and function under high salt and high pH conditions.

  • Lipid interactions: Examining how A. ehrlichii MsbA interacts with potentially modified lipid A structures that might exist in this extremophile.

  • Energy coupling efficiency: Studying whether A. ehrlichii MsbA has evolved more efficient coupling between ATP hydrolysis and transport to meet the energetic challenges of surviving in extreme environments.

  • Conformational flexibility: Analyzing whether the conformational changes of A. ehrlichii MsbA differ from those of mesophilic homologs in ways that reflect adaptation to extreme conditions.

Such studies could reveal general principles of protein adaptation to extreme environments and potentially identify novel structural or functional features that could be exploited for biotechnological applications or protein engineering.

What are the potential applications of MsbA inhibitors in antibacterial development?

Given the essential role of MsbA in the viability of gram-negative bacteria, inhibitors of this protein have potential as novel antibacterial agents. Several approaches could be pursued:

  • Structure-based drug design: Using the high-resolution structures of MsbA with bound substrates or inhibitors to design molecules that specifically block the transport function.

  • ATP-binding site targeting: Developing compounds that interfere with ATP binding or hydrolysis, thereby preventing the energy-dependent transport function of MsbA.

  • Substrate-binding site targeting: Creating molecules that compete with lipid A for binding to MsbA or that lock the protein in an unproductive conformation.

  • Allosteric inhibitors: Identifying compounds that bind to sites distant from the substrate-binding pocket but induce conformational changes that prevent normal function.

What are the current technical challenges in studying MsbA and how might they be overcome?

Several technical challenges currently limit our understanding of MsbA:

Addressing these challenges will require interdisciplinary approaches combining advances in protein biochemistry, structural biology, biophysics, and computational modeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.