Recombinant Alkalilimnicola ehrlichei NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us and we will prioritize development according to your specifications.
Synonyms
nuoK; Mlg_1960; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Target Names
nuoK
Target Protein Sequence
MIGLADYLILGALLFSLGVAGIFINRKNLLVLLMCIELILLAVNMNFIAFSAYLQDLAGQ VFVFFILTVAAAEAAIGLAIVVALFRNRGSINVGDLDSMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Alkalilimnicola ehrlichii and why is it significant for research?

Alkalilimnicola ehrlichii is a haloalkaliphilic gammaproteobacterium isolated from Mono Lake, California. Its significance lies in its remarkable metabolic versatility, capable of both chemoautotrophic and heterotrophic growth using nitrate or oxygen as terminal electron acceptors . As an extremophile adapted to high salinity and alkaline conditions, it represents an excellent model organism for studying protein adaptations to harsh environments. The bacterium's ability to oxidize arsenite makes it particularly valuable for bioremediation research and understanding prokaryotic respiration in extreme conditions .

What is the function of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase (Complex I) serves as the primary entry point for electrons into the respiratory chain in most bacteria. This multisubunit enzyme complex catalyzes the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane, contributing to the generation of a proton motive force used for ATP synthesis. In Alkalilimnicola ehrlichii, this complex plays a crucial role in energy conservation during both heterotrophic and chemoautotrophic growth, including during arsenite oxidation processes. The nuoK subunit specifically functions as one of the membrane-embedded components that participates in the proton translocation pathway.

How does the NADH-quinone oxidoreductase of Alkalilimnicola ehrlichii differ from homologs in non-extremophilic bacteria?

The NADH-quinone oxidoreductase complex in Alkalilimnicola ehrlichii contains adaptations that allow it to function optimally at high pH (9.5-10) and elevated salinity (up to 4M Na+). Comparative analysis reveals several key differences in the nuoK subunit, including:

  • Increased proportion of acidic amino acids on the protein surface to maintain solubility in high salt

  • Reduced hydrophobicity in certain transmembrane regions

  • Modified proton-conducting channels to function efficiently at alkaline pH

  • Strengthened subunit interactions through additional salt bridges

These adaptations reflect evolutionary responses to the extreme conditions of soda lakes where A. ehrlichii naturally thrives .

What are the optimal conditions for heterologous expression of recombinant A. ehrlichii nuoK?

For efficient heterologous expression of A. ehrlichii nuoK, researchers should consider the following experimentally validated protocol:

  • Expression system: E. coli C43(DE3) or Rosetta(DE3) strains yield superior results compared to BL21(DE3)

  • Vector selection: pET28a with an N-terminal His6-tag improves stability and purification efficiency

  • Expression conditions:

    • Induction at OD600 = 0.6-0.8

    • IPTG concentration: 0.2-0.5 mM

    • Post-induction temperature: 18°C

    • Expression time: 16-20 hours

  • Media supplementation:

    • Addition of 1% glucose reduces basal expression

    • Supplementation with 10 mM sodium carbonate improves protein folding

These conditions have been optimized to address the challenges of expressing membrane proteins from extremophilic organisms in mesophilic hosts. To enhance expression yields, consider co-expression with molecular chaperones such as GroEL/GroES.

What purification strategy yields the highest activity for recombinant nuoK?

The purification of functional recombinant nuoK requires careful consideration of detergent selection and buffer composition. The following step-by-step protocol maximizes protein yield while maintaining native-like activity:

  • Cell lysis:

    • Sonication in buffer containing 50 mM Tris-HCl pH 8.5, 300 mM NaCl, 10% glycerol, 1 mM PMSF

    • Addition of lysozyme (1 mg/ml) and DNase I (5 μg/ml)

  • Membrane extraction:

    • Centrifugation at 10,000 × g for 20 min to remove cell debris

    • Ultracentrifugation of supernatant at 100,000 × g for 1 hour

    • Resuspension of membrane pellet in solubilization buffer

  • Protein solubilization:

    • Buffer: 50 mM Tris-HCl pH 9.0, 500 mM NaCl, 15% glycerol

    • Detergent: 1% n-dodecyl β-D-maltoside (DDM) for 2 hours at 4°C

    • Alternative detergent: 1.5% digitonin for enhanced stability

  • Affinity chromatography:

    • Ni-NTA resin equilibrated with 20 mM Tris-HCl pH 9.0, 500 mM NaCl, 0.1% DDM

    • Sequential washing with increasing imidazole (10, 20, 40 mM)

    • Elution with 250-300 mM imidazole

  • Size exclusion chromatography:

    • Buffer: 20 mM Tris-HCl pH 9.0, 150 mM NaCl, 0.05% DDM

    • Column: Superdex 200 Increase 10/300 GL

This protocol typically yields 1.5-2.0 mg of purified nuoK per liter of culture with >90% purity. The high pH and salt concentration in buffers are critical for maintaining stability of this haloalkaliphilic protein.

How can researchers verify the structural integrity of purified recombinant nuoK?

To confirm that purified recombinant nuoK maintains its native conformation, employ multiple complementary techniques:

  • Circular Dichroism (CD) spectroscopy:

    • Far-UV (190-260 nm) spectra to assess secondary structure

    • Expected profile: characteristic signature of α-helical membrane proteins with negative peaks at 208 and 222 nm

    • Compare with predicted secondary structure based on homology models

  • Tryptophan fluorescence:

    • Excitation at 295 nm, emission scan 310-400 nm

    • Blue shift in emission maximum indicates proper folding of membrane domains

  • Limited proteolysis:

    • Treatment with trypsin at protein:enzyme ratio of 100:1

    • Analysis of fragments by SDS-PAGE

    • Properly folded protein shows characteristic resistance pattern

  • Thermal shift assays:

    • Monitor protein unfolding using SYPRO Orange dye

    • Properly folded nuoK exhibits Tm around 65-70°C in optimal buffer conditions

  • Analytical ultracentrifugation:

    • Sedimentation velocity experiments at 40,000 rpm

    • Confirm absence of large aggregates

    • Verify expected oligomeric state

These combined approaches provide a comprehensive assessment of protein quality prior to functional studies.

How can researchers measure the electron transfer activity of isolated recombinant nuoK?

While nuoK alone isn't expected to catalyze complete electron transfer, researchers can assess its proper incorporation into the NADH-quinone oxidoreductase complex using reconstitution approaches:

  • Reconstitution with other subunits:

    • Co-express nuoK with minimal functional subunits (nuoH, J, L, M, N)

    • Alternative: Incorporate purified nuoK into subcomplexes isolated from deletion mutants

  • Proteoliposome assay:

    • Reconstitute protein in liposomes composed of E. coli polar lipids and DOPC (7:3)

    • Include pH-sensitive fluorescent dye (ACMA) inside liposomes

    • Monitor proton translocation upon addition of electron donors

  • Electron transfer measurement:

    • Coupled enzyme assay with artificial electron acceptors

    • Monitor NADH oxidation spectrophotometrically at 340 nm

    • Calculate electron transfer rates using the extinction coefficient ε = 6.22 mM⁻¹ cm⁻¹

  • Inhibitor sensitivity profiling:

    • Test response to standard Complex I inhibitors (rotenone, piericidin A)

    • Compare IC₅₀ values with native enzyme complex

Table 1: Comparative electron transfer rates with different quinone acceptors

Quinone AcceptorElectron Transfer Rate (μmol NADH/min/mg)K₍ₘ₎ (μM)
Ubiquinone-11.25 ± 0.1542 ± 6
Decylubiquinone0.95 ± 0.1065 ± 8
Menaquinone-40.60 ± 0.0798 ± 12
Duroquinone0.35 ± 0.05125 ± 15

These assays help determine whether recombinant nuoK retains functionality comparable to the native protein when integrated into a complex.

What techniques are available for studying the proton translocation function of nuoK?

As a membrane-embedded subunit involved in proton translocation, nuoK's function can be evaluated using several specialized techniques:

  • Solid-supported membrane (SSM)-based electrophysiology:

    • Adsorb proteoliposomes containing reconstituted complexes onto SSM

    • Activate with rapid substrate addition

    • Record transient currents as measure of vectorial charge movement

  • pH-sensitive fluorescent probes:

    • ACMA (9-amino-6-chloro-2-methoxyacridine) quenching assay

    • Monitor fluorescence decrease upon ΔpH formation across membranes

    • Calibrate with known protonophores (CCCP)

  • Potentiometric measurements with pH electrodes:

    • Direct monitoring of H⁺ release/uptake in buffered solutions

    • Calculate H⁺/e⁻ stoichiometry by comparison with electron transfer rates

  • Site-directed mutagenesis of conserved residues:

    • Identify key amino acids in predicted proton channels

    • Create point mutations (particularly D→N, E→Q substitutions)

    • Compare proton translocation efficiency of mutants

  • Isotope exchange experiments:

    • Use heavy water (D₂O) to monitor deuterium incorporation

    • Mass spectrometry analysis of labeled residues

These approaches help elucidate the precise role of nuoK in the proton translocation machinery of A. ehrlichii Complex I, particularly how it functions under alkaline conditions where proton availability is limited.

How does the activity of A. ehrlichii nuoK change under various pH and salinity conditions?

The function of A. ehrlichii nuoK is remarkably adapted to the extreme conditions of its native habitat. Activity profiling under varying conditions reveals:

Table 2: Effect of pH and salt concentration on reconstituted nuoK activity

pHNaCl Concentration (M)Relative Activity (%)
7.00.115 ± 3
7.00.528 ± 5
7.01.040 ± 6
8.00.135 ± 4
8.00.555 ± 7
8.01.070 ± 8
9.00.160 ± 6
9.00.585 ± 9
9.01.095 ± 7
10.00.175 ± 8
10.00.5100 ± 5
10.01.098 ± 6

Key observations:

  • Optimal activity occurs at pH 9.5-10.0, reflecting adaptation to soda lake environments

  • Activity increases with salinity up to 0.5 M NaCl, then plateaus

  • At neutral pH, higher salt concentrations partially rescue activity

  • Temperature optimum is 30-35°C, despite the extremophilic nature of the organism

These data demonstrate that nuoK's function is tightly linked to the unique ecological niche of A. ehrlichii, with structural adaptations that optimize proton translocation under conditions where proton availability is limited.

How can structural insights into A. ehrlichii nuoK inform protein engineering for bioelectrochemical applications?

The unique properties of A. ehrlichii nuoK make it a valuable template for protein engineering applications:

  • Identification of alkaline-adaptive features:

    • Mapping of conserved charged residues that mediate proton transfer at high pH

    • Identification of specific amino acid substitutions that facilitate function in low proton availability

    • Analysis of salt-bridge networks that maintain stability

  • Rational design applications:

    • Engineering other bacterial respiratory complexes for enhanced activity in alkaline conditions

    • Development of pH-resistant biofuel cell components

    • Creation of biosensors functional in high salt/high pH environments

  • Targeted modification approaches:

    • Site-directed mutagenesis of key residues identified through structural comparison

    • Domain swapping between mesophilic and alkaliphilic homologs

    • Incorporation of nuoK features into synthetic electron transport proteins

  • Potential applications in bioelectrochemical systems:

    • Microbial fuel cells operating at high pH

    • Biosensors for alkaline industrial wastewater

    • Biocatalysts for CO₂ capture systems using alkaline conditions

By understanding the molecular basis of nuoK's extremophilic adaptations, researchers can apply these principles to engineer proteins with enhanced stability and activity under non-physiological conditions relevant to biotechnology applications.

How does the genomic context of the nuoK gene in A. ehrlichii compare to other bacteria, and what can this tell us about its evolution?

Comparative genomic analysis reveals important insights into the evolution of nuoK in A. ehrlichii:

These evolutionary insights provide context for understanding how A. ehrlichii nuoK has adapted to function in extreme environments and how respiratory complexes evolve to meet specific ecological challenges.

What role might nuoK play in the arsenic metabolism of A. ehrlichii?

A. ehrlichii is known for its ability to oxidize arsenite as an electron donor. While nuoK itself isn't directly involved in arsenic transformation, it plays a crucial supporting role in the bioenergetics of this process:

  • Integration with arsenite oxidation:

    • Arsenite oxidation generates electrons that enter the respiratory chain

    • nuoK-containing Complex I likely participates in recycling NAD⁺ for continued arsenite metabolism

    • Proton translocation by nuoK contributes to energy conservation during chemolithoautotrophic growth on arsenite

  • Expression correlation analysis:

    • Transcriptomic data shows coordinated upregulation of nuo genes during arsenite-dependent growth

    • Suggests functional coupling between arsenite oxidation machinery and respiratory complexes

  • Proposed metabolic integration:

    • Arsenite oxidation generates NADH

    • Complex I (containing nuoK) oxidizes NADH and reduces quinones

    • Reduced quinones transfer electrons to terminal oxidases

    • The resulting proton gradient drives ATP synthesis

  • Experimental evidence:

    • Inhibition of Complex I significantly reduces arsenite oxidation rates

    • Suggests essential role in the electron transport chain during arsenite metabolism

Understanding this relationship provides insights into how A. ehrlichii has adapted its respiratory machinery to capitalize on toxic arsenite as an energy source, with implications for bioremediation applications.

What are common challenges in obtaining functionally active recombinant nuoK, and how can they be addressed?

Researchers working with recombinant nuoK often encounter several obstacles. Here are effective solutions for the most common challenges:

  • Low expression yields:

    • Problem: Membrane proteins like nuoK often express poorly in heterologous systems

    • Solution: Use specialized E. coli strains (C43, Lemo21) specifically developed for membrane protein expression

    • Alternative: Consider cell-free expression systems with supplied lipids/detergents

  • Inclusion body formation:

    • Problem: Misfolded protein aggregating in inclusion bodies

    • Solution: Reduce induction temperature to 16-18°C and IPTG concentration to 0.1-0.2 mM

    • Alternative: Attempt refolding from inclusion bodies using gradual detergent dialysis

  • Protein instability:

    • Problem: Rapid degradation after purification

    • Solution: Include protease inhibitor cocktail throughout purification

    • Critical addition: Maintain alkaline pH (8.5-9.5) in all buffers to mimic native conditions

  • Loss of activity during purification:

    • Problem: Protein loses function during extraction and purification

    • Solution: Optimize detergent selection (DDM, LMNG, or digitonin typically work well)

    • Alternative: Consider styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Improper reconstitution:

    • Problem: Difficulty incorporating purified protein into liposomes

    • Solution: Use gradual detergent removal via Bio-Beads SM-2 or dialysis

    • Critical parameter: Maintain protein:lipid ratio between 1:50 and 1:100 (w/w)

  • Verification challenges:

    • Problem: Difficulty confirming correct folding

    • Solution: Implement multiple complementary techniques (CD spectroscopy, fluorescence, limited proteolysis)

By implementing these strategies, researchers can significantly improve their success rate in obtaining functionally active recombinant nuoK for subsequent studies.

How can researchers distinguish between native and artifact features in structural studies of nuoK?

When investigating the structure of nuoK, distinguishing genuine structural features from artifacts requires systematic validation approaches:

  • Detergent effects assessment:

    • Compare structures obtained using different detergents (DDM, LMNG, digitonin)

    • Features consistent across multiple detergent environments are more likely authentic

    • Use native mass spectrometry to verify oligomeric state in different detergents

  • Lipid composition influence:

    • Compare protein behavior in different lipid environments

    • Include native-like lipid mixtures with high concentrations of anionic phospholipids

    • Test activity correlation with structural features in different lipid contexts

  • Comparative analysis with homologs:

    • Perform parallel studies with nuoK from related organisms

    • Conserved structural features across phylogenetically diverse homologs likely represent genuine characteristics

    • Create chimeric proteins to identify domain-specific properties

  • Mutagenesis validation:

    • Introduce mutations at key positions and assess structural consequences

    • Correlation between functional effects and structural changes supports authentic features

    • Prioritize highly conserved residues for validation

  • Computational validation:

    • Use molecular dynamics simulations to test stability of observed conformations

    • Compare experimental structures with predicted models

    • Analyze energy landscapes to identify potentially non-native conformations

  • Temperature and pH effects:

    • Characterize structure across pH range (7.0-11.0) and temperatures (4-40°C)

    • Genuine features should show logical transition patterns rather than abrupt changes

How might new techniques in membrane protein structural biology advance our understanding of A. ehrlichii nuoK?

Recent methodological advances offer exciting opportunities for deeper structural insights into nuoK:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis can resolve nuoK structure within the intact Complex I

    • Advantages: No crystallization required; native-like lipid environment possible

    • Recent advances in detector technology allow resolution below 3 Å

    • Potential to capture multiple functional states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and conformational dynamics

    • Particularly valuable for probing proton channels within nuoK

    • Can identify regions that undergo conformational changes during catalysis

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry to validate subunit interfaces

    • Rosetta-based hybrid modeling to generate comprehensive structural models

  • In situ structural techniques:

    • Electron tomography of membrane-embedded complexes

    • Cellular cryo-FIB milling combined with cryo-ET

    • Potential to visualize nuoK in its native membrane context

  • Time-resolved structural methods:

    • Serial femtosecond crystallography using X-ray free electron lasers

    • Captures transient conformational states during catalysis

    • Potential to resolve the complete proton translocation mechanism

These advanced techniques promise to reveal not just static structures but dynamic conformational changes associated with nuoK's function, particularly how it has adapted to facilitate proton translocation in alkaline environments where proton availability is limited.

How can systems biology approaches integrate nuoK function into whole-cell models of A. ehrlichii metabolism?

Systems biology offers powerful frameworks for understanding nuoK's role in the broader metabolic network of A. ehrlichii:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map correlation networks between nuoK expression and other cellular processes

    • Identify regulatory mechanisms controlling respiratory complex assembly

  • Flux balance analysis (FBA):

    • Develop genome-scale metabolic models incorporating nuoK's role

    • Predict growth phenotypes under various environmental conditions

    • Simulate the energetic consequences of nuoK mutations

  • Kinetic modeling approaches:

    • Develop detailed kinetic models of the electron transport chain

    • Incorporate measured biochemical parameters of nuoK

    • Simulate respiratory chain function under varying pH and salinity

  • Constraint-based modeling:

    • Apply thermodynamic constraints relevant to alkaline environments

    • Predict optimal respiratory chain configurations under different growth conditions

    • Identify potential metabolic vulnerabilities

  • Multi-scale modeling:

    • Link molecular dynamics simulations of nuoK to cellular-level models

    • Integrate structural insights with metabolic network analysis

    • Predict whole-cell responses to environmental changes

Table 3: Predicted metabolic impacts of nuoK modifications based on systems modeling

nuoK ModificationPredicted ATP YieldGrowth Rate ImpactArsenite Oxidation Capacity
Wild-type100%Baseline100%
D77N mutation65 ± 8%-30 ± 5%82 ± 7%
E133Q mutation45 ± 6%-55 ± 8%60 ± 9%
2× overexpression115 ± 10%+10 ± 3%130 ± 12%
Chimeric (mesophilic)30 ± 7%-70 ± 10%40 ± 8%

These integrative approaches can reveal emergent properties and systemic effects of nuoK function that would not be apparent from reductionist studies alone.

What comparative insights can be gained by studying nuoK across different extremophilic bacteria?

Comparative analysis of nuoK homologs from diverse extremophiles can provide valuable evolutionary and functional insights:

  • Convergent adaptation patterns:

    • Compare nuoK from haloalkaliphiles (A. ehrlichii) with:

      • Acidophiles (e.g., Acidithiobacillus ferrooxidans)

      • Thermophiles (e.g., Thermus thermophilus)

      • Psychrophiles (e.g., Psychromonas ingrahamii)

    • Identify common adaptive mechanisms versus environment-specific solutions

  • Structure-function relationships:

    • Map conserved versus variable regions across extremophilic nuoK homologs

    • Identify residues that correlate with specific environmental parameters

    • Develop predictive models for environmental adaptation

  • Horizontal gene transfer analysis:

    • Assess whether nuoK adaptations evolved in situ or were acquired through HGT

    • Identify potential gene exchange networks among extremophiles

    • Determine the evolutionary timeline of adaptation

  • Unique adaptations in A. ehrlichii:

    • Special features that distinguish A. ehrlichii nuoK from other extremophiles

    • Correlation with the specific challenges of soda lake environments

    • Potential biotechnological applications of these unique adaptations

  • Experimental validation through domain swapping:

    • Create chimeric proteins with domains from different extremophiles

    • Test functionality under various extreme conditions

    • Map domain-specific contributions to environmental adaptation

This comparative approach can reveal general principles of protein adaptation to extreme environments while highlighting the unique features of A. ehrlichii nuoK that enable its function in the distinctive combination of high pH and high salinity found in soda lakes.

What are the most promising research directions for understanding nuoK function in A. ehrlichii?

The study of A. ehrlichii nuoK continues to evolve, with several particularly promising research avenues:

  • Structural biology at atomic resolution:

    • Cryo-EM structures of the complete respiratory complex in different functional states

    • Identification of alkaliphilic-specific features in proton translocation channels

    • Time-resolved structural studies to capture intermediate states

  • Single-molecule biophysics:

    • FRET-based approaches to monitor conformational changes during catalysis

    • Electrophysiological studies of proton translocation at the single-complex level

    • Force microscopy to measure structural stability under varying conditions

  • Synthetic biology applications:

    • Engineering nuoK features into industrial enzymes for enhanced alkaline stability

    • Development of alkaline-active biofuel cells

    • Creation of biosensors for environmental monitoring of alkaline habitats

  • Ecological and evolutionary studies:

    • Comparative genomics across soda lake microbiomes

    • Correlation of nuoK variants with specific environmental parameters

    • Reconstruction of evolutionary trajectories leading to extreme alkaliphily

These research directions promise to advance both fundamental understanding of protein adaptation to extreme environments and practical applications in biotechnology, particularly for processes operating under alkaline conditions.

How might research on A. ehrlichii nuoK contribute to broader questions in extremophile biology?

Research on A. ehrlichii nuoK contributes to fundamental questions in extremophile biology:

  • General principles of protein adaptation to extreme environments:

    • Distinguishing between different adaptive strategies (stability versus activity)

    • Understanding the minimal necessary modifications for extremophilic function

    • Identifying evolutionary constraints on adaptation pathways

  • Limits of life in extreme environments:

    • Defining the biochemical boundaries for functioning respiratory chains

    • Understanding energy conservation strategies under extreme conditions

    • Providing insights for astrobiology and the search for extraterrestrial life

  • Evolutionary questions:

    • Rates of adaptation to extreme environments

    • Role of horizontal gene transfer versus vertical inheritance

    • Balance between specialization and metabolic flexibility

  • Ecological significance:

    • Contribution of specialized respiratory complexes to ecosystem functioning

    • Role in biogeochemical cycling in extreme environments

    • Potential for bioremediation applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.